Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 42903..43157 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP085625 | ||
| Organism | Escherichia coli strain EC71 | ||
Toxin (Protein)
| Gene name | srnB | Uniprot ID | G9G1E3 |
| Locus tag | LJN53_RS25270 | Protein ID | WP_001312851.1 |
| Coordinates | 42903..43052 (-) | Length | 50 a.a. |
Antitoxin (RNA)
| Gene name | srnC | ||
| Locus tag | - | ||
| Coordinates | 43096..43157 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| LJN53_RS25225 (38476) | 38476..38877 | - | 402 | WP_001398199.1 | type II toxin-antitoxin system toxin endoribonuclease PemK | - |
| LJN53_RS25230 (38810) | 38810..39067 | - | 258 | WP_000557619.1 | type II toxin-antitoxin system antitoxin PemI | - |
| LJN53_RS25235 (39160) | 39160..39468 | - | 309 | WP_226116723.1 | CPBP family intramembrane metalloprotease | - |
| LJN53_RS25240 (39410) | 39410..39802 | - | 393 | WP_000616804.1 | histidine phosphatase family protein | - |
| LJN53_RS25245 (40731) | 40731..41588 | - | 858 | WP_000774297.1 | incFII family plasmid replication initiator RepA | - |
| LJN53_RS25250 (41581) | 41581..42063 | - | 483 | WP_001273588.1 | hypothetical protein | - |
| LJN53_RS25255 (42056) | 42056..42103 | - | 48 | WP_229471593.1 | hypothetical protein | - |
| LJN53_RS25260 (42094) | 42094..42345 | + | 252 | WP_223195197.1 | replication protein RepA | - |
| LJN53_RS25265 (42362) | 42362..42619 | - | 258 | WP_000083845.1 | replication regulatory protein RepA | - |
| LJN53_RS25270 (42903) | 42903..43052 | - | 150 | WP_001312851.1 | Hok/Gef family protein | Toxin |
| - (43096) | 43096..43157 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (43096) | 43096..43157 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (43096) | 43096..43157 | + | 62 | NuclAT_1 | - | Antitoxin |
| - (43096) | 43096..43157 | + | 62 | NuclAT_1 | - | Antitoxin |
| LJN53_RS25275 (43413) | 43413..43487 | - | 75 | Protein_53 | endonuclease | - |
| LJN53_RS25280 (43733) | 43733..43945 | - | 213 | WP_001299730.1 | ANR family transcriptional regulator | - |
| LJN53_RS25285 (44081) | 44081..44641 | - | 561 | WP_000139315.1 | fertility inhibition protein FinO | - |
| LJN53_RS25290 (44744) | 44744..45604 | - | 861 | WP_000704514.1 | alpha/beta hydrolase | - |
| LJN53_RS25295 (45663) | 45663..46409 | - | 747 | WP_000205749.1 | conjugal transfer pilus acetylase TraX | - |
| LJN53_RS25300 (46429) | 46429..47673 | - | 1245 | Protein_58 | conjugative transfer relaxase/helicase TraI | - |
| LJN53_RS25305 (47675) | 47675..47857 | - | 183 | Protein_59 | conjugal transfer protein TraH | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | dfrA17 / blaTEM-1B / tet(B) / catA1 / sul2 / aph(3'')-Ib / aph(6)-Id / aph(3')-Ia / sitABCD | iutA / iucD / iucC / iucB / iucA | 1..82796 | 82796 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 50 a.a. Molecular weight: 5542.67 Da Isoelectric Point: 8.7678
>T220963 WP_001312851.1 NZ_CP085625:c43052-42903 [Escherichia coli]
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
MTKYALIGLLAVCATVLCFSLIFRERLCELNIHRGNTVVQVTLAYEARK
Download Length: 150 bp
>T220963 NZ_CP117317:3374439-3374657 [Salmonella enterica subsp. enterica serovar Derby]
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAACTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACGATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA
ATGTCTGATAAACCATTAACTAAAACTGATTATTTGATGCGTTTACGGCGCTGTCAGACAATTGACACTCTGGAGCGCGT
CATTGAGAAAAATAAATATGAATTGTCCGACAATGAACTGGCTGTATTTTACTCAGCTGCGGATCACCGTCTTGCAGAAT
TGACGATGAACAAACTCTACGACAAGATCCCCTCTTCAGTATGGAAATTCATTCGTTAA
Antitoxin
Download Length: 62 bp
>AT220963 NZ_CP085625:43096-43157 [Escherichia coli]
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
TTAAGGTACTTCATGCAGACCTCACGAGTTAATGGATTAACGAGTGGGGTCTTCGCATTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|