Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2009140..2009439 | Replicon | chromosome |
| Accession | NZ_CP083671 | ||
| Organism | Staphylococcus aureus strain HL25870 | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | Q2FWU9 |
| Locus tag | K3A99_RS09865 | Protein ID | WP_011447039.1 |
| Coordinates | 2009263..2009439 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2009140..2009195 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K3A99_RS09825 | 2004471..2004731 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| K3A99_RS09830 | 2004784..2005134 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| K3A99_RS09835 | 2005819..2006268 | + | 450 | WP_000727649.1 | chemotaxis-inhibiting protein CHIPS | - |
| K3A99_RS09840 | 2006363..2006698 | - | 336 | Protein_1900 | SH3 domain-containing protein | - |
| K3A99_RS09845 | 2007348..2007839 | - | 492 | WP_000919350.1 | staphylokinase | - |
| K3A99_RS09850 | 2008030..2008785 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| K3A99_RS09855 | 2008797..2009051 | - | 255 | WP_000611512.1 | phage holin | - |
| K3A99_RS09860 | 2009103..2009210 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2009132..2009271 | + | 140 | NuclAT_0 | - | - |
| - | 2009132..2009271 | + | 140 | NuclAT_0 | - | - |
| - | 2009132..2009271 | + | 140 | NuclAT_0 | - | - |
| - | 2009132..2009271 | + | 140 | NuclAT_0 | - | - |
| - | 2009140..2009195 | + | 56 | - | - | Antitoxin |
| K3A99_RS09865 | 2009263..2009439 | - | 177 | WP_011447039.1 | type I toxin-antitoxin system toxin PepG1 | Toxin |
| K3A99_RS09870 | 2009589..2009885 | - | 297 | WP_000539688.1 | DUF2951 domain-containing protein | - |
| K3A99_RS09875 | 2009943..2010230 | - | 288 | WP_001040261.1 | hypothetical protein | - |
| K3A99_RS09880 | 2010277..2010429 | - | 153 | WP_001153681.1 | hypothetical protein | - |
| K3A99_RS09885 | 2010419..2014204 | - | 3786 | WP_000582165.1 | phage tail spike protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / chp / sak / hlb / groEL | 2004784..2057204 | 52420 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6849.45 Da Isoelectric Point: 10.6777
>T217059 WP_011447039.1 NZ_CP083671:c2009439-2009263 [Staphylococcus aureus]
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMVALLKSLERRRLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T217059 NZ_CP113784:c2468720-2468502 [Citrobacter freundii]
ATGTCCGATAAACCATTAACTAAAACAGATTATTTGATGCGCCTGCGACGTTGCCAGACAATTGATACGCTAGAGCGCGT
TATTGAAAAAAATAAATATGAATTGTCCGACAACGAACTGGCTGTATTTTACTCAGCAGCAGATCATCGCCTTGCTGAAT
TGACCATGAATAAGCTTTACGACAAGATTCCAACTTCTGTTTGGAAATTCATTCGCTAA
ATGTCCGATAAACCATTAACTAAAACAGATTATTTGATGCGCCTGCGACGTTGCCAGACAATTGATACGCTAGAGCGCGT
TATTGAAAAAAATAAATATGAATTGTCCGACAACGAACTGGCTGTATTTTACTCAGCAGCAGATCATCGCCTTGCTGAAT
TGACCATGAATAAGCTTTACGACAAGATTCCAACTTCTGTTTGGAAATTCATTCGCTAA
Antitoxin
Download Length: 56 bp
>AT217059 NZ_CP083671:2009140-2009195 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|