Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 943102..943322 | Replicon | chromosome |
| Accession | NZ_CP083263 | ||
| Organism | Escherichia coli strain JNU | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | B7LGX8 |
| Locus tag | K6T58_RS04690 | Protein ID | WP_000170965.1 |
| Coordinates | 943215..943322 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 943102..943168 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K6T58_RS04665 | 938381..939775 | - | 1395 | WP_000086212.1 | inverse autotransporter invasin YchO | - |
| K6T58_RS04670 | 939960..940313 | + | 354 | WP_001169666.1 | DsrE/F sulfur relay family protein YchN | - |
| K6T58_RS04675 | 940357..941052 | - | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| K6T58_RS04680 | 941210..941440 | - | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| K6T58_RS04685 | 941710..942810 | + | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| - | 943102..943168 | - | 67 | - | - | Antitoxin |
| K6T58_RS04690 | 943215..943322 | + | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 943635..943698 | - | 64 | NuclAT_32 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_32 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_32 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_32 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_34 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_34 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_34 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_34 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_36 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_36 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_36 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_36 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_38 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_38 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_38 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_38 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_40 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_40 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_40 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_40 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_42 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_42 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_42 | - | - |
| - | 943635..943698 | - | 64 | NuclAT_42 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_44 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_44 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_44 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_44 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_47 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_47 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_47 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_47 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_50 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_50 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_50 | - | - |
| - | 943636..943698 | - | 63 | NuclAT_50 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_14 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_14 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_14 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_14 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_17 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_17 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_17 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_17 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_20 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_20 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_20 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_20 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_23 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_23 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_23 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_23 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_26 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_26 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_26 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_26 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_29 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_29 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_29 | - | - |
| - | 943637..943698 | - | 62 | NuclAT_29 | - | - |
| K6T58_RS04695 | 943751..943858 | + | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 944172..944238 | - | 67 | NuclAT_43 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_43 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_43 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_43 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_46 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_46 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_46 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_46 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_49 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_49 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_49 | - | - |
| - | 944172..944238 | - | 67 | NuclAT_49 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_15 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_15 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_15 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_15 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_18 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_18 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_18 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_18 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_21 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_21 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_21 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_21 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_24 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_24 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_24 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_24 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_27 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_27 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_27 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_27 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_30 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_30 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_30 | - | - |
| - | 944173..944236 | - | 64 | NuclAT_30 | - | - |
| K6T58_RS04700 | 944286..944393 | + | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| K6T58_RS04705 | 944542..945396 | - | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| K6T58_RS04710 | 945432..946241 | - | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| K6T58_RS04715 | 946245..946637 | - | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| K6T58_RS04720 | 946634..947467 | - | 834 | WP_000456571.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T216217 WP_000170965.1 NZ_CP083263:943215-943322 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T216217 NZ_CP112996:c3032414-3032019 [Mycobacterium tuberculosis variant bovis]
GTGATCGTCGATACGTCGGCCATCGTCGCCATCGTGAGCGGGGAATCGGGCGCGCAGGTGCTCAAGGAGGCGCTGGAGCG
GTCACCGAACTCCCGAATGTCCGCGCCCAACTACGTCGAACTGTGCGCGATCATGCAGCGGCGGGACCGGCCGGAGATCT
CTCGATTGGTGGACCGTTTGCTGGACGACTACGGAATCCAGGTCGAAGCCGTCGACGCCGACCAAGCCCGCGTGGCCGCG
CAGGCGTATCGCGACTACGGCCGCGGCAGCGGCCATCCGGCCCGTCTCAACCTCGGCGACACCTACAGCTACGCCCTGGC
CCAGGTCACCGGGGAGCCGCTGCTGTTTCGTGGCGATGACTTCACGCATACCGATATCCGGCCCGCGTGCACCTGA
GTGATCGTCGATACGTCGGCCATCGTCGCCATCGTGAGCGGGGAATCGGGCGCGCAGGTGCTCAAGGAGGCGCTGGAGCG
GTCACCGAACTCCCGAATGTCCGCGCCCAACTACGTCGAACTGTGCGCGATCATGCAGCGGCGGGACCGGCCGGAGATCT
CTCGATTGGTGGACCGTTTGCTGGACGACTACGGAATCCAGGTCGAAGCCGTCGACGCCGACCAAGCCCGCGTGGCCGCG
CAGGCGTATCGCGACTACGGCCGCGGCAGCGGCCATCCGGCCCGTCTCAACCTCGGCGACACCTACAGCTACGCCCTGGC
CCAGGTCACCGGGGAGCCGCTGCTGTTTCGTGGCGATGACTTCACGCATACCGATATCCGGCCCGCGTGCACCTGA
Antitoxin
Download Length: 67 bp
>AT216217 NZ_CP083263:c943168-943102 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|