Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 943102..943322 Replicon chromosome
Accession NZ_CP083263
Organism Escherichia coli strain JNU

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag K6T58_RS04690 Protein ID WP_000170965.1
Coordinates 943215..943322 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 943102..943168 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
K6T58_RS04665 938381..939775 - 1395 WP_000086212.1 inverse autotransporter invasin YchO -
K6T58_RS04670 939960..940313 + 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -
K6T58_RS04675 940357..941052 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
K6T58_RS04680 941210..941440 - 231 WP_001146442.1 putative cation transport regulator ChaB -
K6T58_RS04685 941710..942810 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 943102..943168 - 67 - - Antitoxin
K6T58_RS04690 943215..943322 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 943635..943698 - 64 NuclAT_32 - -
- 943635..943698 - 64 NuclAT_32 - -
- 943635..943698 - 64 NuclAT_32 - -
- 943635..943698 - 64 NuclAT_32 - -
- 943635..943698 - 64 NuclAT_34 - -
- 943635..943698 - 64 NuclAT_34 - -
- 943635..943698 - 64 NuclAT_34 - -
- 943635..943698 - 64 NuclAT_34 - -
- 943635..943698 - 64 NuclAT_36 - -
- 943635..943698 - 64 NuclAT_36 - -
- 943635..943698 - 64 NuclAT_36 - -
- 943635..943698 - 64 NuclAT_36 - -
- 943635..943698 - 64 NuclAT_38 - -
- 943635..943698 - 64 NuclAT_38 - -
- 943635..943698 - 64 NuclAT_38 - -
- 943635..943698 - 64 NuclAT_38 - -
- 943635..943698 - 64 NuclAT_40 - -
- 943635..943698 - 64 NuclAT_40 - -
- 943635..943698 - 64 NuclAT_40 - -
- 943635..943698 - 64 NuclAT_40 - -
- 943635..943698 - 64 NuclAT_42 - -
- 943635..943698 - 64 NuclAT_42 - -
- 943635..943698 - 64 NuclAT_42 - -
- 943635..943698 - 64 NuclAT_42 - -
- 943636..943698 - 63 NuclAT_44 - -
- 943636..943698 - 63 NuclAT_44 - -
- 943636..943698 - 63 NuclAT_44 - -
- 943636..943698 - 63 NuclAT_44 - -
- 943636..943698 - 63 NuclAT_47 - -
- 943636..943698 - 63 NuclAT_47 - -
- 943636..943698 - 63 NuclAT_47 - -
- 943636..943698 - 63 NuclAT_47 - -
- 943636..943698 - 63 NuclAT_50 - -
- 943636..943698 - 63 NuclAT_50 - -
- 943636..943698 - 63 NuclAT_50 - -
- 943636..943698 - 63 NuclAT_50 - -
- 943637..943698 - 62 NuclAT_14 - -
- 943637..943698 - 62 NuclAT_14 - -
- 943637..943698 - 62 NuclAT_14 - -
- 943637..943698 - 62 NuclAT_14 - -
- 943637..943698 - 62 NuclAT_17 - -
- 943637..943698 - 62 NuclAT_17 - -
- 943637..943698 - 62 NuclAT_17 - -
- 943637..943698 - 62 NuclAT_17 - -
- 943637..943698 - 62 NuclAT_20 - -
- 943637..943698 - 62 NuclAT_20 - -
- 943637..943698 - 62 NuclAT_20 - -
- 943637..943698 - 62 NuclAT_20 - -
- 943637..943698 - 62 NuclAT_23 - -
- 943637..943698 - 62 NuclAT_23 - -
- 943637..943698 - 62 NuclAT_23 - -
- 943637..943698 - 62 NuclAT_23 - -
- 943637..943698 - 62 NuclAT_26 - -
- 943637..943698 - 62 NuclAT_26 - -
- 943637..943698 - 62 NuclAT_26 - -
- 943637..943698 - 62 NuclAT_26 - -
- 943637..943698 - 62 NuclAT_29 - -
- 943637..943698 - 62 NuclAT_29 - -
- 943637..943698 - 62 NuclAT_29 - -
- 943637..943698 - 62 NuclAT_29 - -
K6T58_RS04695 943751..943858 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 944172..944238 - 67 NuclAT_43 - -
- 944172..944238 - 67 NuclAT_43 - -
- 944172..944238 - 67 NuclAT_43 - -
- 944172..944238 - 67 NuclAT_43 - -
- 944172..944238 - 67 NuclAT_46 - -
- 944172..944238 - 67 NuclAT_46 - -
- 944172..944238 - 67 NuclAT_46 - -
- 944172..944238 - 67 NuclAT_46 - -
- 944172..944238 - 67 NuclAT_49 - -
- 944172..944238 - 67 NuclAT_49 - -
- 944172..944238 - 67 NuclAT_49 - -
- 944172..944238 - 67 NuclAT_49 - -
- 944173..944236 - 64 NuclAT_15 - -
- 944173..944236 - 64 NuclAT_15 - -
- 944173..944236 - 64 NuclAT_15 - -
- 944173..944236 - 64 NuclAT_15 - -
- 944173..944236 - 64 NuclAT_18 - -
- 944173..944236 - 64 NuclAT_18 - -
- 944173..944236 - 64 NuclAT_18 - -
- 944173..944236 - 64 NuclAT_18 - -
- 944173..944236 - 64 NuclAT_21 - -
- 944173..944236 - 64 NuclAT_21 - -
- 944173..944236 - 64 NuclAT_21 - -
- 944173..944236 - 64 NuclAT_21 - -
- 944173..944236 - 64 NuclAT_24 - -
- 944173..944236 - 64 NuclAT_24 - -
- 944173..944236 - 64 NuclAT_24 - -
- 944173..944236 - 64 NuclAT_24 - -
- 944173..944236 - 64 NuclAT_27 - -
- 944173..944236 - 64 NuclAT_27 - -
- 944173..944236 - 64 NuclAT_27 - -
- 944173..944236 - 64 NuclAT_27 - -
- 944173..944236 - 64 NuclAT_30 - -
- 944173..944236 - 64 NuclAT_30 - -
- 944173..944236 - 64 NuclAT_30 - -
- 944173..944236 - 64 NuclAT_30 - -
K6T58_RS04700 944286..944393 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
K6T58_RS04705 944542..945396 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
K6T58_RS04710 945432..946241 - 810 WP_001257044.1 invasion regulator SirB1 -
K6T58_RS04715 946245..946637 - 393 WP_000200378.1 invasion regulator SirB2 -
K6T58_RS04720 946634..947467 - 834 WP_000456571.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T216217 WP_000170965.1 NZ_CP083263:943215-943322 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T216217 NZ_CP112996:c3032414-3032019 [Mycobacterium tuberculosis variant bovis]
GTGATCGTCGATACGTCGGCCATCGTCGCCATCGTGAGCGGGGAATCGGGCGCGCAGGTGCTCAAGGAGGCGCTGGAGCG
GTCACCGAACTCCCGAATGTCCGCGCCCAACTACGTCGAACTGTGCGCGATCATGCAGCGGCGGGACCGGCCGGAGATCT
CTCGATTGGTGGACCGTTTGCTGGACGACTACGGAATCCAGGTCGAAGCCGTCGACGCCGACCAAGCCCGCGTGGCCGCG
CAGGCGTATCGCGACTACGGCCGCGGCAGCGGCCATCCGGCCCGTCTCAACCTCGGCGACACCTACAGCTACGCCCTGGC
CCAGGTCACCGGGGAGCCGCTGCTGTTTCGTGGCGATGACTTCACGCATACCGATATCCGGCCCGCGTGCACCTGA

Antitoxin


Download         Length: 67 bp

>AT216217 NZ_CP083263:c943168-943102 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References