Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 29106..29331 | Replicon | chromosome |
| Accession | NZ_CP082916 | ||
| Organism | Salmonella enterica subsp. enterica serovar Newlands strain ZC-S1 3rd | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | K8862_RS00160 | Protein ID | WP_000813254.1 |
| Coordinates | 29106..29261 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 29273..29331 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| K8862_RS00125 | 24213..24494 | - | 282 | WP_000445513.1 | phage holin family protein | - |
| K8862_RS00130 | 24484..24672 | - | 189 | WP_001688615.1 | putative holin | - |
| K8862_RS00135 | 24666..24989 | - | 324 | Protein_26 | tellurite/colicin resistance protein | - |
| K8862_RS00140 | 27160..27696 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
| K8862_RS00145 | 27693..27983 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
| K8862_RS00150 | 27983..28582 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
| K8862_RS00155 | 28645..28815 | - | 171 | WP_000734094.1 | hypothetical protein | - |
| K8862_RS00160 | 29106..29261 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 29273..29331 | + | 59 | - | - | Antitoxin |
| K8862_RS00165 | 29688..30620 | + | 933 | WP_000556390.1 | hypothetical protein | - |
| K8862_RS00170 | 30617..31171 | + | 555 | WP_001033796.1 | hypothetical protein | - |
| K8862_RS00175 | 31333..31662 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
| K8862_RS23140 | 31706..31753 | - | 48 | Protein_35 | hypothetical protein | - |
| K8862_RS00185 | 31935..32402 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
| K8862_RS00190 | 32787..32942 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
| K8862_RS00195 | 33050..33571 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
| K8862_RS00200 | 34009..34230 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 23671..35542 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T215554 WP_000813254.1 NZ_CP082916:c29261-29106 [Salmonella enterica subsp. enterica serovar Newlands]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T215554 NZ_CP110814:2609874-2609981 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT215554 NZ_CP082916:29273-29331 [Salmonella enterica subsp. enterica serovar Newlands]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|