Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
| Location | 4792277..4792498 | Replicon | chromosome |
| Accession | NZ_CP076706 | ||
| Organism | Escherichia coli O170:H18 strain CFIAFB20120266 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | J7R083 |
| Locus tag | KQ217_RS23240 | Protein ID | WP_000170963.1 |
| Coordinates | 4792277..4792384 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | agrB | ||
| Locus tag | - | ||
| Coordinates | 4792432..4792498 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KQ217_RS23215 (4788121) | 4788121..4789203 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| KQ217_RS23220 (4789203) | 4789203..4790036 | + | 834 | WP_000456474.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| KQ217_RS23225 (4790033) | 4790033..4790425 | + | 393 | WP_000200375.1 | invasion regulator SirB2 | - |
| KQ217_RS23230 (4790429) | 4790429..4791238 | + | 810 | WP_001257055.1 | invasion regulator SirB1 | - |
| KQ217_RS23235 (4791274) | 4791274..4792128 | + | 855 | WP_053270399.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| KQ217_RS23240 (4792277) | 4792277..4792384 | - | 108 | WP_000170963.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_16 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_16 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_16 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_16 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_18 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_18 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_18 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_18 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_20 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_20 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_20 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_20 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_22 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_22 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_22 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_22 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_23 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_23 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_23 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_23 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_25 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_25 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_25 | - | - |
| - (4792434) | 4792434..4792497 | + | 64 | NuclAT_25 | - | - |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_10 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_10 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_10 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_10 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_11 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_11 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_11 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_11 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_12 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_13 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_8 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_9 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_9 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_9 | - | Antitoxin |
| - (4792432) | 4792432..4792498 | + | 67 | NuclAT_9 | - | Antitoxin |
| KQ217_RS23245 (4792789) | 4792789..4793889 | - | 1101 | WP_000063608.1 | sodium-potassium/proton antiporter ChaA | - |
| KQ217_RS23250 (4794159) | 4794159..4794389 | + | 231 | WP_001146452.1 | putative cation transport regulator ChaB | - |
| KQ217_RS23255 (4794547) | 4794547..4795242 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| KQ217_RS23260 (4795286) | 4795286..4795639 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
| KQ217_RS23265 (4795824) | 4795824..4797218 | + | 1395 | WP_000086188.1 | inverse autotransporter invasin YchO | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3971.74 Da Isoelectric Point: 11.4779
>T206408 WP_000170963.1 NZ_CP076706:c4792384-4792277 [Escherichia coli O170:H18]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T206408 NZ_CP102380:c1519410-1519123 [Escherichia coli]
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA
Antitoxin
Download Length: 67 bp
>AT206408 NZ_CP076706:4792432-4792498 [Escherichia coli O170:H18]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGGTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGGTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|