Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 4792277..4792498 Replicon chromosome
Accession NZ_CP076706
Organism Escherichia coli O170:H18 strain CFIAFB20120266

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag KQ217_RS23240 Protein ID WP_000170963.1
Coordinates 4792277..4792384 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 4792432..4792498 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KQ217_RS23215 (4788121) 4788121..4789203 + 1083 WP_000804726.1 peptide chain release factor 1 -
KQ217_RS23220 (4789203) 4789203..4790036 + 834 WP_000456474.1 peptide chain release factor N(5)-glutamine methyltransferase -
KQ217_RS23225 (4790033) 4790033..4790425 + 393 WP_000200375.1 invasion regulator SirB2 -
KQ217_RS23230 (4790429) 4790429..4791238 + 810 WP_001257055.1 invasion regulator SirB1 -
KQ217_RS23235 (4791274) 4791274..4792128 + 855 WP_053270399.1 3-deoxy-8-phosphooctulonate synthase -
KQ217_RS23240 (4792277) 4792277..4792384 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4792434) 4792434..4792497 + 64 NuclAT_16 - -
- (4792434) 4792434..4792497 + 64 NuclAT_16 - -
- (4792434) 4792434..4792497 + 64 NuclAT_16 - -
- (4792434) 4792434..4792497 + 64 NuclAT_16 - -
- (4792434) 4792434..4792497 + 64 NuclAT_18 - -
- (4792434) 4792434..4792497 + 64 NuclAT_18 - -
- (4792434) 4792434..4792497 + 64 NuclAT_18 - -
- (4792434) 4792434..4792497 + 64 NuclAT_18 - -
- (4792434) 4792434..4792497 + 64 NuclAT_20 - -
- (4792434) 4792434..4792497 + 64 NuclAT_20 - -
- (4792434) 4792434..4792497 + 64 NuclAT_20 - -
- (4792434) 4792434..4792497 + 64 NuclAT_20 - -
- (4792434) 4792434..4792497 + 64 NuclAT_22 - -
- (4792434) 4792434..4792497 + 64 NuclAT_22 - -
- (4792434) 4792434..4792497 + 64 NuclAT_22 - -
- (4792434) 4792434..4792497 + 64 NuclAT_22 - -
- (4792434) 4792434..4792497 + 64 NuclAT_23 - -
- (4792434) 4792434..4792497 + 64 NuclAT_23 - -
- (4792434) 4792434..4792497 + 64 NuclAT_23 - -
- (4792434) 4792434..4792497 + 64 NuclAT_23 - -
- (4792434) 4792434..4792497 + 64 NuclAT_25 - -
- (4792434) 4792434..4792497 + 64 NuclAT_25 - -
- (4792434) 4792434..4792497 + 64 NuclAT_25 - -
- (4792434) 4792434..4792497 + 64 NuclAT_25 - -
- (4792432) 4792432..4792498 + 67 NuclAT_10 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_10 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_10 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_10 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_11 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_11 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_11 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_11 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_12 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_12 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_12 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_12 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_13 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_13 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_13 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_13 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_8 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_8 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_8 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_8 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_9 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_9 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_9 - Antitoxin
- (4792432) 4792432..4792498 + 67 NuclAT_9 - Antitoxin
KQ217_RS23245 (4792789) 4792789..4793889 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
KQ217_RS23250 (4794159) 4794159..4794389 + 231 WP_001146452.1 putative cation transport regulator ChaB -
KQ217_RS23255 (4794547) 4794547..4795242 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
KQ217_RS23260 (4795286) 4795286..4795639 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
KQ217_RS23265 (4795824) 4795824..4797218 + 1395 WP_000086188.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T206408 WP_000170963.1 NZ_CP076706:c4792384-4792277 [Escherichia coli O170:H18]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T206408 NZ_CP102380:c1519410-1519123 [Escherichia coli]
ATGGCGTATTTTCTGGATTTTGACGAGCGGGCACTAAAGGAATGGCGAAAGCTGGGCTCGACGGTACGTGAACAGTTGAA
AAAGAAGCTGGTTGAAGTACTTGAGTCACCCCGGATTGAAGCAAACAAGCTCCGTGGTATGCCTGATTGTTACAAGATTA
AGCTCCGGTCTTCAGGCTATCGCCTTGTATACCAGGTTATAGACGAGAAAGTTGTCGTTTTCGTGATTTCTGTTGGGAAA
AGAGAACGCTCGGAAGTATATAGCGAGGCGGTCAAACGCATTCTCTGA

Antitoxin


Download         Length: 67 bp

>AT206408 NZ_CP076706:4792432-4792498 [Escherichia coli O170:H18]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGGTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References