Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 2704317..2704575 | Replicon | chromosome |
Accession | NZ_CP076595 | ||
Organism | Erwinia amylovora isolate CP20130202 |
Toxin (Protein)
Gene name | hok | Uniprot ID | - |
Locus tag | KQH34_RS12425 | Protein ID | WP_231840709.1 |
Coordinates | 2704477..2704575 (+) | Length | 33 a.a. |
Antitoxin (RNA)
Gene name | sok | ||
Locus tag | - | ||
Coordinates | 2704317..2704363 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KQH34_RS12380 (KQH34_12350) | 2699763..2699906 | - | 144 | WP_004160049.1 | hypothetical protein | - |
KQH34_RS12385 (KQH34_12355) | 2700379..2700771 | - | 393 | WP_004160048.1 | DoxX family protein | - |
KQH34_RS12390 (KQH34_12360) | 2700981..2701262 | - | 282 | WP_004160039.1 | YqjK-like family protein | - |
KQH34_RS12395 (KQH34_12365) | 2701262..2701654 | - | 393 | WP_004160038.1 | phage holin family protein | - |
KQH34_RS12400 (KQH34_12370) | 2701656..2701961 | - | 306 | WP_004160037.1 | DUF883 family protein | - |
KQH34_RS12405 (KQH34_12375) | 2702004..2702375 | - | 372 | WP_004160036.1 | DUF1090 domain-containing protein | - |
KQH34_RS12410 (KQH34_12380) | 2702543..2702935 | - | 393 | WP_004160035.1 | EnvZ/OmpR regulon moderator MzrA | - |
KQH34_RS12415 (KQH34_12385) | 2702932..2703606 | - | 675 | WP_004160034.1 | DedA family protein | - |
- | 2704317..2704363 | - | 47 | - | - | Antitoxin |
KQH34_RS12425 | 2704477..2704575 | + | 99 | WP_231840709.1 | Hok/Gef family protein | Toxin |
KQH34_RS12430 (KQH34_12395) | 2704719..2705951 | - | 1233 | WP_004160030.1 | serine/threonine transporter SstT | - |
KQH34_RS12435 (KQH34_12400) | 2706186..2707166 | - | 981 | WP_013035818.1 | TerC family protein | - |
KQH34_RS12440 (KQH34_12405) | 2707579..2709270 | + | 1692 | WP_004160025.1 | chloride channel protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 33 a.a. Molecular weight: 3810.40 Da Isoelectric Point: 8.9407
>T206018 WP_231840709.1 NZ_CP076595:2704477-2704575 [Erwinia amylovora]
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
IFTYLTRKSLCEIRYKDGYREVAAFMAYESGK
Download Length: 99 bp
>T206018 NZ_CP102070:c306190-306095 [Enterococcus faecalis]
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
ATGTACGAGATTGTCACAAAAATTCTTGTGCCGATTTTTGTCGGGATTGTCCTGAAACTTGTAACCATTTGGTTGGAAAA
ACAGAACGAGGAATAA
Antitoxin
Download Length: 47 bp
>AT206018 NZ_CP076595:c2704363-2704317 [Erwinia amylovora]
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
GCATGCAGATGGCCTCGTGGATTAATGAAAATTAACTACGGGGCTTT
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|