Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2709169..2709383 Replicon chromosome
Accession NZ_CP076237
Organism Escherichia coli O157:H7 strain 146N4

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag JKN67_RS13795 Protein ID WP_000170963.1
Coordinates 2709169..2709276 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2709324..2709383 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JKN67_RS13765 (2704478) 2704478..2705560 + 1083 WP_000804726.1 peptide chain release factor 1 -
JKN67_RS13770 (2705560) 2705560..2706393 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
JKN67_RS13775 (2706390) 2706390..2706782 + 393 WP_000200379.1 invasion regulator SirB2 -
JKN67_RS13780 (2706786) 2706786..2707595 + 810 WP_001257044.1 invasion regulator SirB1 -
JKN67_RS13785 (2707631) 2707631..2708485 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
JKN67_RS13790 (2708633) 2708633..2708740 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2708793) 2708793..2708854 + 62 NuclAT_24 - -
- (2708793) 2708793..2708854 + 62 NuclAT_24 - -
- (2708793) 2708793..2708854 + 62 NuclAT_24 - -
- (2708793) 2708793..2708854 + 62 NuclAT_24 - -
- (2708793) 2708793..2708854 + 62 NuclAT_26 - -
- (2708793) 2708793..2708854 + 62 NuclAT_26 - -
- (2708793) 2708793..2708854 + 62 NuclAT_26 - -
- (2708793) 2708793..2708854 + 62 NuclAT_26 - -
- (2708793) 2708793..2708854 + 62 NuclAT_28 - -
- (2708793) 2708793..2708854 + 62 NuclAT_28 - -
- (2708793) 2708793..2708854 + 62 NuclAT_28 - -
- (2708793) 2708793..2708854 + 62 NuclAT_28 - -
- (2708793) 2708793..2708854 + 62 NuclAT_30 - -
- (2708793) 2708793..2708854 + 62 NuclAT_30 - -
- (2708793) 2708793..2708854 + 62 NuclAT_30 - -
- (2708793) 2708793..2708854 + 62 NuclAT_30 - -
- (2708793) 2708793..2708854 + 62 NuclAT_32 - -
- (2708793) 2708793..2708854 + 62 NuclAT_32 - -
- (2708793) 2708793..2708854 + 62 NuclAT_32 - -
- (2708793) 2708793..2708854 + 62 NuclAT_32 - -
- (2708793) 2708793..2708855 + 63 NuclAT_17 - -
- (2708793) 2708793..2708855 + 63 NuclAT_17 - -
- (2708793) 2708793..2708855 + 63 NuclAT_17 - -
- (2708793) 2708793..2708855 + 63 NuclAT_17 - -
- (2708793) 2708793..2708855 + 63 NuclAT_18 - -
- (2708793) 2708793..2708855 + 63 NuclAT_18 - -
- (2708793) 2708793..2708855 + 63 NuclAT_18 - -
- (2708793) 2708793..2708855 + 63 NuclAT_18 - -
- (2708793) 2708793..2708855 + 63 NuclAT_19 - -
- (2708793) 2708793..2708855 + 63 NuclAT_19 - -
- (2708793) 2708793..2708855 + 63 NuclAT_19 - -
- (2708793) 2708793..2708855 + 63 NuclAT_19 - -
- (2708793) 2708793..2708855 + 63 NuclAT_20 - -
- (2708793) 2708793..2708855 + 63 NuclAT_20 - -
- (2708793) 2708793..2708855 + 63 NuclAT_20 - -
- (2708793) 2708793..2708855 + 63 NuclAT_20 - -
- (2708793) 2708793..2708855 + 63 NuclAT_22 - -
- (2708793) 2708793..2708855 + 63 NuclAT_22 - -
- (2708793) 2708793..2708855 + 63 NuclAT_22 - -
- (2708793) 2708793..2708855 + 63 NuclAT_22 - -
- (2708793) 2708793..2708855 + 63 NuclAT_23 - -
- (2708793) 2708793..2708855 + 63 NuclAT_23 - -
- (2708793) 2708793..2708855 + 63 NuclAT_23 - -
- (2708793) 2708793..2708855 + 63 NuclAT_23 - -
JKN67_RS13795 (2709169) 2709169..2709276 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2709324) 2709324..2709383 + 60 NuclAT_25 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_25 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_25 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_25 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_27 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_27 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_27 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_27 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_29 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_29 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_29 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_29 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_31 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_31 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_31 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_31 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_33 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_33 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_33 - Antitoxin
- (2709324) 2709324..2709383 + 60 NuclAT_33 - Antitoxin
JKN67_RS13800 (2709675) 2709675..2710775 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
JKN67_RS13805 (2711045) 2711045..2711275 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JKN67_RS13810 (2711436) 2711436..2712131 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
JKN67_RS13815 (2712175) 2712175..2712528 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
JKN67_RS13820 (2712714) 2712714..2714108 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T204879 WP_000170963.1 NZ_CP076237:c2709276-2709169 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T204879 NZ_CP101274:c2652234-2652131 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT

Antitoxin


Download         Length: 60 bp

>AT204879 NZ_CP076237:2709324-2709383 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References