Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-sokW/Ldr(toxin) |
| Location | 283113..283334 | Replicon | chromosome |
| Accession | NZ_CP076237 | ||
| Organism | Escherichia coli O157:H7 strain 146N4 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | JKN67_RS01365 | Protein ID | WP_001295224.1 |
| Coordinates | 283227..283334 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 283113..283178 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| JKN67_RS01345 (278553) | 278553..279455 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| JKN67_RS01350 (279466) | 279466..280449 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| JKN67_RS01355 (280446) | 280446..281450 | + | 1005 | WP_000107027.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| JKN67_RS01360 (281480) | 281480..282751 | - | 1272 | WP_001301684.1 | aromatic amino acid transport family protein | - |
| - (283113) | 283113..283178 | - | 66 | NuclAT_16 | - | Antitoxin |
| - (283113) | 283113..283178 | - | 66 | NuclAT_16 | - | Antitoxin |
| - (283113) | 283113..283178 | - | 66 | NuclAT_16 | - | Antitoxin |
| - (283113) | 283113..283178 | - | 66 | NuclAT_16 | - | Antitoxin |
| - (283113) | 283113..283178 | - | 66 | NuclAT_21 | - | Antitoxin |
| - (283113) | 283113..283178 | - | 66 | NuclAT_21 | - | Antitoxin |
| - (283113) | 283113..283178 | - | 66 | NuclAT_21 | - | Antitoxin |
| - (283113) | 283113..283178 | - | 66 | NuclAT_21 | - | Antitoxin |
| JKN67_RS01365 (283227) | 283227..283334 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| JKN67_RS01370 (283421) | 283421..285100 | - | 1680 | WP_000191596.1 | cellulose biosynthesis protein BcsG | - |
| JKN67_RS01375 (285097) | 285097..285288 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| JKN67_RS01380 (285285) | 285285..286856 | - | 1572 | WP_001204920.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| JKN67_RS01385 (287129) | 287129..287317 | + | 189 | WP_001063316.1 | cellulose biosynthesis protein BcsR | - |
| JKN67_RS01390 (287329) | 287329..288081 | + | 753 | Protein_275 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T204862 WP_001295224.1 NZ_CP076237:283227-283334 [Escherichia coli O157:H7]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T204862 NZ_CP101269:c4327394-4327221 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACTTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACTTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG
Antitoxin
Download Length: 66 bp
>AT204862 NZ_CP076237:c283178-283113 [Escherichia coli O157:H7]
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
GTCTAGGTTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|