Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2431345..2431570 | Replicon | chromosome |
| Accession | NZ_CP074661 | ||
| Organism | Salmonella enterica subsp. enterica serovar Enteritidis strain CFSAN008104 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | A9D71_RS11735 | Protein ID | WP_000813254.1 |
| Coordinates | 2431345..2431500 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2431512..2431570 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| A9D71_RS11710 | 2426906..2427229 | - | 324 | Protein_2300 | tellurite/colicin resistance protein | - |
| A9D71_RS11715 | 2429399..2429935 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
| A9D71_RS11720 | 2429932..2430222 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
| A9D71_RS11725 | 2430222..2430821 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
| A9D71_RS11730 | 2430884..2431054 | - | 171 | WP_000734094.1 | hypothetical protein | - |
| A9D71_RS11735 | 2431345..2431500 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2431512..2431570 | + | 59 | - | - | Antitoxin |
| A9D71_RS11740 | 2431927..2432859 | + | 933 | WP_000556389.1 | hypothetical protein | - |
| A9D71_RS11745 | 2432856..2433410 | + | 555 | WP_001033796.1 | hypothetical protein | - |
| A9D71_RS11750 | 2433572..2433901 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
| A9D71_RS23055 | 2433945..2433992 | - | 48 | Protein_2309 | hypothetical protein | - |
| A9D71_RS11760 | 2434174..2434641 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
| A9D71_RS11765 | 2435026..2435181 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
| A9D71_RS11770 | 2435289..2435810 | - | 522 | WP_069057667.1 | super-infection exclusion protein B | - |
| A9D71_RS11775 | 2436248..2436469 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2426903..2435810 | 8907 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T202543 WP_000813254.1 NZ_CP074661:c2431500-2431345 [Salmonella enterica subsp. enterica serovar Enteritidis]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T202543 NZ_CP099499:c514156-513968 [Staphylococcus aureus]
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
ATGTCTTTACATTTTGCAATTCTGTTTTGGCTAGCATTAATTTTCTTAGTTGCCGCTACGTTTATACTCGTATTAATGAA
AAAAACTGGCAAAGAATCTAAAAAAGAGTCCTATTTAAGTTTCACTGTCATTCTCTATATTTTTGGATTCGCTATATTAA
TATACACATTTATATTTGGTGTGCTATAA
Antitoxin
Download Length: 59 bp
>AT202543 NZ_CP074661:2431512-2431570 [Salmonella enterica subsp. enterica serovar Enteritidis]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|