Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 2443971..2444196 | Replicon | chromosome |
| Accession | NZ_CP074428 | ||
| Organism | Salmonella sp. SJTUF14523 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | S1ELB5 |
| Locus tag | KFD69_RS11825 | Protein ID | WP_000813254.1 |
| Coordinates | 2443971..2444126 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 2444138..2444196 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KFD69_RS11790 | 2439078..2439359 | - | 282 | WP_000445513.1 | phage holin family protein | - |
| KFD69_RS11795 | 2439349..2439537 | - | 189 | WP_001688615.1 | putative holin | - |
| KFD69_RS11800 | 2439531..2439854 | - | 324 | Protein_2322 | tellurite/colicin resistance protein | - |
| KFD69_RS11805 | 2442025..2442561 | - | 537 | WP_000640113.1 | DUF1133 family protein | - |
| KFD69_RS11810 | 2442558..2442848 | - | 291 | WP_000774470.1 | DUF1364 domain-containing protein | - |
| KFD69_RS11815 | 2442848..2443447 | - | 600 | WP_000940751.1 | DUF1367 family protein | - |
| KFD69_RS11820 | 2443510..2443680 | - | 171 | WP_000734094.1 | hypothetical protein | - |
| KFD69_RS11825 | 2443971..2444126 | - | 156 | WP_000813254.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| - | 2444138..2444196 | + | 59 | - | - | Antitoxin |
| KFD69_RS11830 | 2444553..2445485 | + | 933 | WP_000556390.1 | hypothetical protein | - |
| KFD69_RS11835 | 2445482..2446036 | + | 555 | WP_001033796.1 | hypothetical protein | - |
| KFD69_RS11840 | 2446198..2446527 | - | 330 | WP_001676916.1 | DUF977 family protein | - |
| KFD69_RS23815 | 2446571..2446618 | - | 48 | Protein_2331 | hypothetical protein | - |
| KFD69_RS11850 | 2446800..2447267 | + | 468 | WP_001227859.1 | helix-turn-helix domain-containing protein | - |
| KFD69_RS11855 | 2447652..2447807 | + | 156 | WP_085981757.1 | DUF1391 family protein | - |
| KFD69_RS11860 | 2447915..2448436 | - | 522 | WP_000004762.1 | super-infection exclusion protein B | - |
| KFD69_RS11865 | 2448874..2449095 | + | 222 | WP_000560208.1 | cell division protein FtsZ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2438536..2450407 | 11871 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5736.89 Da Isoelectric Point: 6.1531
>T202112 WP_000813254.1 NZ_CP074428:c2444126-2443971 [Salmonella sp. SJTUF14523]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T202112 NZ_CP099316:2830971-2831150 [Enterobacter hormaechei]
ATGGATAGCAGGAATGCAATAGCAATGATAGAAGCCGATGGGTGGTATCTGGTGAGAGTTAAAGGCAGTCATCACCAGTT
CAAACACCCAACGAAAAAGGGGCTGGTAACGGTAAAGCATCCACAGAAAGACATACCGTTACCAACACTGAAAAGCATCA
AAAAACAGGCGGGGCTCTAA
ATGGATAGCAGGAATGCAATAGCAATGATAGAAGCCGATGGGTGGTATCTGGTGAGAGTTAAAGGCAGTCATCACCAGTT
CAAACACCCAACGAAAAAGGGGCTGGTAACGGTAAAGCATCCACAGAAAGACATACCGTTACCAACACTGAAAAGCATCA
AAAAACAGGCGGGGCTCTAA
Antitoxin
Download Length: 59 bp
>AT202112 NZ_CP074428:2444138-2444196 [Salmonella sp. SJTUF14523]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGCAAAGCATGAAATTGGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|