Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2735176..2735396 Replicon chromosome
Accession NZ_CP073929
Organism Escherichia coli strain MB64

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag KFU91_RS13130 Protein ID WP_000170965.1
Coordinates 2735289..2735396 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2735176..2735242 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KFU91_RS13105 2730454..2731848 - 1395 WP_001400233.1 inverse autotransporter invasin YchO -
KFU91_RS13110 2732034..2732387 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
KFU91_RS13115 2732431..2733126 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
KFU91_RS13120 2733284..2733514 - 231 WP_001146444.1 putative cation transport regulator ChaB -
KFU91_RS13125 2733784..2734884 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 2735176..2735242 - 67 - - Antitoxin
KFU91_RS13130 2735289..2735396 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2735710..2735775 - 66 NuclAT_14 - -
- 2735710..2735775 - 66 NuclAT_14 - -
- 2735710..2735775 - 66 NuclAT_14 - -
- 2735710..2735775 - 66 NuclAT_14 - -
- 2735710..2735775 - 66 NuclAT_16 - -
- 2735710..2735775 - 66 NuclAT_16 - -
- 2735710..2735775 - 66 NuclAT_16 - -
- 2735710..2735775 - 66 NuclAT_16 - -
- 2735710..2735775 - 66 NuclAT_18 - -
- 2735710..2735775 - 66 NuclAT_18 - -
- 2735710..2735775 - 66 NuclAT_18 - -
- 2735710..2735775 - 66 NuclAT_18 - -
- 2735710..2735775 - 66 NuclAT_20 - -
- 2735710..2735775 - 66 NuclAT_20 - -
- 2735710..2735775 - 66 NuclAT_20 - -
- 2735710..2735775 - 66 NuclAT_20 - -
- 2735710..2735775 - 66 NuclAT_22 - -
- 2735710..2735775 - 66 NuclAT_22 - -
- 2735710..2735775 - 66 NuclAT_22 - -
- 2735710..2735775 - 66 NuclAT_22 - -
- 2735710..2735775 - 66 NuclAT_24 - -
- 2735710..2735775 - 66 NuclAT_24 - -
- 2735710..2735775 - 66 NuclAT_24 - -
- 2735710..2735775 - 66 NuclAT_24 - -
- 2735711..2735776 - 66 NuclAT_26 - -
- 2735711..2735776 - 66 NuclAT_26 - -
- 2735711..2735776 - 66 NuclAT_26 - -
- 2735711..2735776 - 66 NuclAT_26 - -
- 2735711..2735776 - 66 NuclAT_29 - -
- 2735711..2735776 - 66 NuclAT_29 - -
- 2735711..2735776 - 66 NuclAT_29 - -
- 2735711..2735776 - 66 NuclAT_29 - -
- 2735711..2735776 - 66 NuclAT_32 - -
- 2735711..2735776 - 66 NuclAT_32 - -
- 2735711..2735776 - 66 NuclAT_32 - -
- 2735711..2735776 - 66 NuclAT_32 - -
- 2735711..2735776 - 66 NuclAT_35 - -
- 2735711..2735776 - 66 NuclAT_35 - -
- 2735711..2735776 - 66 NuclAT_35 - -
- 2735711..2735776 - 66 NuclAT_35 - -
- 2735711..2735776 - 66 NuclAT_39 - -
- 2735711..2735776 - 66 NuclAT_39 - -
- 2735711..2735776 - 66 NuclAT_39 - -
- 2735711..2735776 - 66 NuclAT_39 - -
- 2735711..2735776 - 66 NuclAT_42 - -
- 2735711..2735776 - 66 NuclAT_42 - -
- 2735711..2735776 - 66 NuclAT_42 - -
- 2735711..2735776 - 66 NuclAT_42 - -
KFU91_RS13135 2735824..2735931 + 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2736245..2736311 - 67 NuclAT_13 - -
- 2736245..2736311 - 67 NuclAT_13 - -
- 2736245..2736311 - 67 NuclAT_13 - -
- 2736245..2736311 - 67 NuclAT_13 - -
- 2736245..2736311 - 67 NuclAT_15 - -
- 2736245..2736311 - 67 NuclAT_15 - -
- 2736245..2736311 - 67 NuclAT_15 - -
- 2736245..2736311 - 67 NuclAT_15 - -
- 2736245..2736311 - 67 NuclAT_17 - -
- 2736245..2736311 - 67 NuclAT_17 - -
- 2736245..2736311 - 67 NuclAT_17 - -
- 2736245..2736311 - 67 NuclAT_17 - -
- 2736245..2736311 - 67 NuclAT_19 - -
- 2736245..2736311 - 67 NuclAT_19 - -
- 2736245..2736311 - 67 NuclAT_19 - -
- 2736245..2736311 - 67 NuclAT_19 - -
- 2736245..2736311 - 67 NuclAT_21 - -
- 2736245..2736311 - 67 NuclAT_21 - -
- 2736245..2736311 - 67 NuclAT_21 - -
- 2736245..2736311 - 67 NuclAT_21 - -
- 2736245..2736311 - 67 NuclAT_23 - -
- 2736245..2736311 - 67 NuclAT_23 - -
- 2736245..2736311 - 67 NuclAT_23 - -
- 2736245..2736311 - 67 NuclAT_23 - -
- 2736246..2736309 - 64 NuclAT_28 - -
- 2736246..2736309 - 64 NuclAT_28 - -
- 2736246..2736309 - 64 NuclAT_28 - -
- 2736246..2736309 - 64 NuclAT_28 - -
- 2736246..2736309 - 64 NuclAT_31 - -
- 2736246..2736309 - 64 NuclAT_31 - -
- 2736246..2736309 - 64 NuclAT_31 - -
- 2736246..2736309 - 64 NuclAT_31 - -
- 2736246..2736309 - 64 NuclAT_34 - -
- 2736246..2736309 - 64 NuclAT_34 - -
- 2736246..2736309 - 64 NuclAT_34 - -
- 2736246..2736309 - 64 NuclAT_34 - -
- 2736246..2736309 - 64 NuclAT_37 - -
- 2736246..2736309 - 64 NuclAT_37 - -
- 2736246..2736309 - 64 NuclAT_37 - -
- 2736246..2736309 - 64 NuclAT_37 - -
- 2736246..2736309 - 64 NuclAT_41 - -
- 2736246..2736309 - 64 NuclAT_41 - -
- 2736246..2736309 - 64 NuclAT_41 - -
- 2736246..2736309 - 64 NuclAT_41 - -
- 2736246..2736309 - 64 NuclAT_44 - -
- 2736246..2736309 - 64 NuclAT_44 - -
- 2736246..2736309 - 64 NuclAT_44 - -
- 2736246..2736309 - 64 NuclAT_44 - -
KFU91_RS13140 2736359..2736466 + 108 WP_000170951.1 type I toxin-antitoxin system toxin Ldr family protein -
KFU91_RS13145 2736613..2737467 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
KFU91_RS13150 2737503..2738312 - 810 WP_001257044.1 invasion regulator SirB1 -
KFU91_RS13155 2738316..2738708 - 393 WP_000200373.1 invasion regulator SirB2 -
KFU91_RS13160 2738705..2739538 - 834 WP_000456454.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T200610 WP_000170965.1 NZ_CP073929:2735289-2735396 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T200610 NZ_CP098040:2724513-2724815 [Providencia rettgeri]
ATGATCACGGTTCTAACAACGGAATGTTTTGATAGTTGGATTAAAAATCTTAGAGATATTCGAGCTAAAACTAAAATTCT
AATGAGAATTAGGCGGTTAAAAAATGGAAATTATGGTGATGTTCAACCCATTGGTGATGGCTTTTCGGAACTGAGGGTAC
ATGAAGGACAAGGGTATCGTGTTTATCTAAAGCAGAAAAACAATGTTATTGTAATTTTACTTTGTGGTGGGACAAAGGCA
ACGCAGCAGAAGGATATCCATAAAGCTAAACTTCTTTTTGGTGAAGTTGAGGGGGAACTATGA

Antitoxin


Download         Length: 67 bp

>AT200610 NZ_CP073929:c2735242-2735176 [Escherichia coli]
TGTCCGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References