Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5174942..5175163 Replicon chromosome
Accession NZ_CP071263
Organism Escherichia coli strain MEI003

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag J0G23_RS24875 Protein ID WP_000176713.1
Coordinates 5174942..5175049 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5175097..5175163 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
J0G23_RS24850 (5170787) 5170787..5171869 + 1083 WP_000804726.1 peptide chain release factor 1 -
J0G23_RS24855 (5171869) 5171869..5172702 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
J0G23_RS24860 (5172699) 5172699..5173091 + 393 WP_000151883.1 invasion regulator SirB2 -
J0G23_RS24865 (5173095) 5173095..5173904 + 810 WP_001257058.1 invasion regulator SirB1 -
J0G23_RS24870 (5173940) 5173940..5174794 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
J0G23_RS24875 (5174942) 5174942..5175049 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (5175099) 5175099..5175162 + 64 NuclAT_37 - -
- (5175099) 5175099..5175162 + 64 NuclAT_37 - -
- (5175099) 5175099..5175162 + 64 NuclAT_37 - -
- (5175099) 5175099..5175162 + 64 NuclAT_37 - -
- (5175099) 5175099..5175162 + 64 NuclAT_39 - -
- (5175099) 5175099..5175162 + 64 NuclAT_39 - -
- (5175099) 5175099..5175162 + 64 NuclAT_39 - -
- (5175099) 5175099..5175162 + 64 NuclAT_39 - -
- (5175099) 5175099..5175162 + 64 NuclAT_41 - -
- (5175099) 5175099..5175162 + 64 NuclAT_41 - -
- (5175099) 5175099..5175162 + 64 NuclAT_41 - -
- (5175099) 5175099..5175162 + 64 NuclAT_41 - -
- (5175097) 5175097..5175163 + 67 NuclAT_16 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_16 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_16 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_16 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_20 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_20 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_20 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_20 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_24 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_24 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_24 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_24 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_28 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_28 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_28 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_28 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_30 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_30 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_30 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_30 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_34 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_34 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_34 - Antitoxin
- (5175097) 5175097..5175163 + 67 NuclAT_34 - Antitoxin
J0G23_RS24880 (5175477) 5175477..5175584 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (5175637) 5175637..5175698 + 62 NuclAT_36 - -
- (5175637) 5175637..5175698 + 62 NuclAT_36 - -
- (5175637) 5175637..5175698 + 62 NuclAT_36 - -
- (5175637) 5175637..5175698 + 62 NuclAT_36 - -
- (5175637) 5175637..5175698 + 62 NuclAT_38 - -
- (5175637) 5175637..5175698 + 62 NuclAT_38 - -
- (5175637) 5175637..5175698 + 62 NuclAT_38 - -
- (5175637) 5175637..5175698 + 62 NuclAT_38 - -
- (5175637) 5175637..5175698 + 62 NuclAT_40 - -
- (5175637) 5175637..5175698 + 62 NuclAT_40 - -
- (5175637) 5175637..5175698 + 62 NuclAT_40 - -
- (5175637) 5175637..5175698 + 62 NuclAT_40 - -
- (5175637) 5175637..5175699 + 63 NuclAT_17 - -
- (5175637) 5175637..5175699 + 63 NuclAT_17 - -
- (5175637) 5175637..5175699 + 63 NuclAT_17 - -
- (5175637) 5175637..5175699 + 63 NuclAT_17 - -
- (5175637) 5175637..5175699 + 63 NuclAT_21 - -
- (5175637) 5175637..5175699 + 63 NuclAT_21 - -
- (5175637) 5175637..5175699 + 63 NuclAT_21 - -
- (5175637) 5175637..5175699 + 63 NuclAT_21 - -
- (5175637) 5175637..5175699 + 63 NuclAT_25 - -
- (5175637) 5175637..5175699 + 63 NuclAT_25 - -
- (5175637) 5175637..5175699 + 63 NuclAT_25 - -
- (5175637) 5175637..5175699 + 63 NuclAT_25 - -
- (5175637) 5175637..5175699 + 63 NuclAT_29 - -
- (5175637) 5175637..5175699 + 63 NuclAT_29 - -
- (5175637) 5175637..5175699 + 63 NuclAT_29 - -
- (5175637) 5175637..5175699 + 63 NuclAT_29 - -
- (5175637) 5175637..5175699 + 63 NuclAT_31 - -
- (5175637) 5175637..5175699 + 63 NuclAT_31 - -
- (5175637) 5175637..5175699 + 63 NuclAT_31 - -
- (5175637) 5175637..5175699 + 63 NuclAT_31 - -
- (5175637) 5175637..5175699 + 63 NuclAT_35 - -
- (5175637) 5175637..5175699 + 63 NuclAT_35 - -
- (5175637) 5175637..5175699 + 63 NuclAT_35 - -
- (5175637) 5175637..5175699 + 63 NuclAT_35 - -
J0G23_RS24885 (5175990) 5175990..5177090 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
J0G23_RS24890 (5177360) 5177360..5177590 + 231 WP_001578208.1 putative cation transport regulator ChaB -
J0G23_RS24895 (5177748) 5177748..5178443 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
J0G23_RS24900 (5178487) 5178487..5178840 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T196112 WP_000176713.1 NZ_CP071263:c5175049-5174942 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T196112 NZ_CP095021:1014698-1015132 [Mycobacterium tuberculosis]
ATGGCGAAACTGTCCGGATCCATCGACGTACCGCTGCCACCGGAGGAAGCCTGGATGCACGCCTCCGATCTGACTCGTTA
CCGAGAGTGGCTGACCATCCACAAGGTATGGCGCAGCAAGTTGCCCGAAGTGCTCGAGAAGGGCACGGTCGTCGAGTCGT
ATGTCGAGGTCAAGGGCATGCCCAACCGGATCAAGTGGACGATCGTGCGGTACAAACCCCCGGAGGGCATGACGCTCAAC
GGCGACGGTGTGGGTGGTGTCAAAGTCAAGCTGATCGCTAAGGTAGCGCCGAAAGAGCACGGCTCCGTCGTCAGCTTCGA
TGTGCACCTCGGCGGCCCGGCCCTGCTCGGGCCGATCGGCATGATCGTCGCCGCTGCATTGCGAGCCGACATCCGCGAAT
CGCTGCAGAACTTCGTCACGGTGTTTGCCGGCTGA

Antitoxin


Download         Length: 67 bp

>AT196112 NZ_CP071263:5175097-5175163 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References