Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2159933..2160154 Replicon chromosome
Accession NZ_CP071073
Organism Escherichia coli strain 3347558

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag JY392_RS10635 Protein ID WP_000170965.1
Coordinates 2159933..2160040 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2160088..2160154 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JY392_RS10610 (2155778) 2155778..2156860 + 1083 WP_000804726.1 peptide chain release factor 1 -
JY392_RS10615 (2156860) 2156860..2157693 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
JY392_RS10620 (2157690) 2157690..2158082 + 393 WP_000151883.1 invasion regulator SirB2 -
JY392_RS10625 (2158086) 2158086..2158895 + 810 WP_001257044.1 invasion regulator SirB1 -
JY392_RS10630 (2158931) 2158931..2159785 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JY392_RS10635 (2159933) 2159933..2160040 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (2160090) 2160090..2160153 + 64 NuclAT_29 - -
- (2160090) 2160090..2160153 + 64 NuclAT_29 - -
- (2160090) 2160090..2160153 + 64 NuclAT_29 - -
- (2160090) 2160090..2160153 + 64 NuclAT_29 - -
- (2160090) 2160090..2160153 + 64 NuclAT_31 - -
- (2160090) 2160090..2160153 + 64 NuclAT_31 - -
- (2160090) 2160090..2160153 + 64 NuclAT_31 - -
- (2160090) 2160090..2160153 + 64 NuclAT_31 - -
- (2160090) 2160090..2160153 + 64 NuclAT_33 - -
- (2160090) 2160090..2160153 + 64 NuclAT_33 - -
- (2160090) 2160090..2160153 + 64 NuclAT_33 - -
- (2160090) 2160090..2160153 + 64 NuclAT_33 - -
- (2160090) 2160090..2160153 + 64 NuclAT_35 - -
- (2160090) 2160090..2160153 + 64 NuclAT_35 - -
- (2160090) 2160090..2160153 + 64 NuclAT_35 - -
- (2160090) 2160090..2160153 + 64 NuclAT_35 - -
- (2160090) 2160090..2160153 + 64 NuclAT_37 - -
- (2160090) 2160090..2160153 + 64 NuclAT_37 - -
- (2160090) 2160090..2160153 + 64 NuclAT_37 - -
- (2160090) 2160090..2160153 + 64 NuclAT_37 - -
- (2160090) 2160090..2160153 + 64 NuclAT_39 - -
- (2160090) 2160090..2160153 + 64 NuclAT_39 - -
- (2160090) 2160090..2160153 + 64 NuclAT_39 - -
- (2160090) 2160090..2160153 + 64 NuclAT_39 - -
- (2160088) 2160088..2160154 + 67 NuclAT_16 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_16 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_16 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_16 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_18 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_18 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_18 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_18 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_20 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_20 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_20 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_20 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_22 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_22 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_22 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_22 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_24 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_24 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_24 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_24 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_26 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_26 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_26 - Antitoxin
- (2160088) 2160088..2160154 + 67 NuclAT_26 - Antitoxin
- (2160090) 2160090..2160155 + 66 NuclAT_41 - -
- (2160090) 2160090..2160155 + 66 NuclAT_41 - -
- (2160090) 2160090..2160155 + 66 NuclAT_41 - -
- (2160090) 2160090..2160155 + 66 NuclAT_41 - -
JY392_RS10640 (2160468) 2160468..2160575 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (2160628) 2160628..2160689 + 62 NuclAT_28 - -
- (2160628) 2160628..2160689 + 62 NuclAT_28 - -
- (2160628) 2160628..2160689 + 62 NuclAT_28 - -
- (2160628) 2160628..2160689 + 62 NuclAT_28 - -
- (2160628) 2160628..2160689 + 62 NuclAT_30 - -
- (2160628) 2160628..2160689 + 62 NuclAT_30 - -
- (2160628) 2160628..2160689 + 62 NuclAT_30 - -
- (2160628) 2160628..2160689 + 62 NuclAT_30 - -
- (2160628) 2160628..2160689 + 62 NuclAT_32 - -
- (2160628) 2160628..2160689 + 62 NuclAT_32 - -
- (2160628) 2160628..2160689 + 62 NuclAT_32 - -
- (2160628) 2160628..2160689 + 62 NuclAT_32 - -
- (2160628) 2160628..2160689 + 62 NuclAT_34 - -
- (2160628) 2160628..2160689 + 62 NuclAT_34 - -
- (2160628) 2160628..2160689 + 62 NuclAT_34 - -
- (2160628) 2160628..2160689 + 62 NuclAT_34 - -
- (2160628) 2160628..2160689 + 62 NuclAT_36 - -
- (2160628) 2160628..2160689 + 62 NuclAT_36 - -
- (2160628) 2160628..2160689 + 62 NuclAT_36 - -
- (2160628) 2160628..2160689 + 62 NuclAT_36 - -
- (2160628) 2160628..2160689 + 62 NuclAT_38 - -
- (2160628) 2160628..2160689 + 62 NuclAT_38 - -
- (2160628) 2160628..2160689 + 62 NuclAT_38 - -
- (2160628) 2160628..2160689 + 62 NuclAT_38 - -
- (2160628) 2160628..2160690 + 63 NuclAT_17 - -
- (2160628) 2160628..2160690 + 63 NuclAT_17 - -
- (2160628) 2160628..2160690 + 63 NuclAT_17 - -
- (2160628) 2160628..2160690 + 63 NuclAT_17 - -
- (2160628) 2160628..2160690 + 63 NuclAT_19 - -
- (2160628) 2160628..2160690 + 63 NuclAT_19 - -
- (2160628) 2160628..2160690 + 63 NuclAT_19 - -
- (2160628) 2160628..2160690 + 63 NuclAT_19 - -
- (2160628) 2160628..2160690 + 63 NuclAT_21 - -
- (2160628) 2160628..2160690 + 63 NuclAT_21 - -
- (2160628) 2160628..2160690 + 63 NuclAT_21 - -
- (2160628) 2160628..2160690 + 63 NuclAT_21 - -
- (2160628) 2160628..2160690 + 63 NuclAT_23 - -
- (2160628) 2160628..2160690 + 63 NuclAT_23 - -
- (2160628) 2160628..2160690 + 63 NuclAT_23 - -
- (2160628) 2160628..2160690 + 63 NuclAT_23 - -
- (2160628) 2160628..2160690 + 63 NuclAT_25 - -
- (2160628) 2160628..2160690 + 63 NuclAT_25 - -
- (2160628) 2160628..2160690 + 63 NuclAT_25 - -
- (2160628) 2160628..2160690 + 63 NuclAT_25 - -
- (2160628) 2160628..2160690 + 63 NuclAT_27 - -
- (2160628) 2160628..2160690 + 63 NuclAT_27 - -
- (2160628) 2160628..2160690 + 63 NuclAT_27 - -
- (2160628) 2160628..2160690 + 63 NuclAT_27 - -
- (2160628) 2160628..2160691 + 64 NuclAT_40 - -
- (2160628) 2160628..2160691 + 64 NuclAT_40 - -
- (2160628) 2160628..2160691 + 64 NuclAT_40 - -
- (2160628) 2160628..2160691 + 64 NuclAT_40 - -
JY392_RS10645 (2160981) 2160981..2162081 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
JY392_RS10650 (2162351) 2162351..2162581 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JY392_RS10655 (2162739) 2162739..2163434 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
JY392_RS10660 (2163478) 2163478..2163831 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T195210 WP_000170965.1 NZ_CP071073:c2160040-2159933 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T195210 NZ_CP094359:c2526892-2526602 [Acidithiobacillus sp. YTS05]
ATGGCCAAACTTGCCCCTTTTGACGCTGCTGACTACCTCGACGACGAAGAAACCATCGCGGAGTTCTTGACCGCGGCACT
GGAAGATCAAAACCCCGACGTGTTTCTTTCCGCCGTTCGTGACGTTGCCCGAGCCCGCGGCATGGCACAACTCGCCAAGG
ACGCTGGCCTTGGCCGCGAGAGTCTCTACAAAGCCCTCACACCGGGCGCCAAACCACGTTATGACACTATGCTAAAGTTG
CTTCATGCCCTGGGTGTCAAGCTTTCTGCGACGCCGCTGATTCATTCATGA

Antitoxin


Download         Length: 67 bp

>AT195210 NZ_CP071073:2160088-2160154 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References