Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 3295719..3295940 Replicon chromosome
Accession NZ_CP069882
Organism Escherichia coli strain FDAARGOS_1289

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag I6K19_RS15730 Protein ID WP_000170965.1
Coordinates 3295719..3295826 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 3295874..3295940 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6K19_RS15705 (3291564) 3291564..3292646 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6K19_RS15710 (3292646) 3292646..3293479 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6K19_RS15715 (3293476) 3293476..3293868 + 393 WP_000151883.1 invasion regulator SirB2 -
I6K19_RS15720 (3293872) 3293872..3294681 + 810 WP_001257044.1 invasion regulator SirB1 -
I6K19_RS15725 (3294717) 3294717..3295571 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6K19_RS15730 (3295719) 3295719..3295826 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (3295876) 3295876..3295939 + 64 NuclAT_28 - -
- (3295876) 3295876..3295939 + 64 NuclAT_28 - -
- (3295876) 3295876..3295939 + 64 NuclAT_28 - -
- (3295876) 3295876..3295939 + 64 NuclAT_28 - -
- (3295876) 3295876..3295939 + 64 NuclAT_30 - -
- (3295876) 3295876..3295939 + 64 NuclAT_30 - -
- (3295876) 3295876..3295939 + 64 NuclAT_30 - -
- (3295876) 3295876..3295939 + 64 NuclAT_30 - -
- (3295876) 3295876..3295939 + 64 NuclAT_32 - -
- (3295876) 3295876..3295939 + 64 NuclAT_32 - -
- (3295876) 3295876..3295939 + 64 NuclAT_32 - -
- (3295876) 3295876..3295939 + 64 NuclAT_32 - -
- (3295876) 3295876..3295939 + 64 NuclAT_34 - -
- (3295876) 3295876..3295939 + 64 NuclAT_34 - -
- (3295876) 3295876..3295939 + 64 NuclAT_34 - -
- (3295876) 3295876..3295939 + 64 NuclAT_34 - -
- (3295876) 3295876..3295939 + 64 NuclAT_36 - -
- (3295876) 3295876..3295939 + 64 NuclAT_36 - -
- (3295876) 3295876..3295939 + 64 NuclAT_36 - -
- (3295876) 3295876..3295939 + 64 NuclAT_36 - -
- (3295876) 3295876..3295939 + 64 NuclAT_38 - -
- (3295876) 3295876..3295939 + 64 NuclAT_38 - -
- (3295876) 3295876..3295939 + 64 NuclAT_38 - -
- (3295876) 3295876..3295939 + 64 NuclAT_38 - -
- (3295874) 3295874..3295940 + 67 NuclAT_15 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_15 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_15 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_15 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_17 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_17 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_17 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_17 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_19 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_19 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_19 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_19 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_21 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_21 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_21 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_21 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_23 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_23 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_23 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_23 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_25 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_25 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_25 - Antitoxin
- (3295874) 3295874..3295940 + 67 NuclAT_25 - Antitoxin
- (3295876) 3295876..3295941 + 66 NuclAT_40 - -
- (3295876) 3295876..3295941 + 66 NuclAT_40 - -
- (3295876) 3295876..3295941 + 66 NuclAT_40 - -
- (3295876) 3295876..3295941 + 66 NuclAT_40 - -
- (3295876) 3295876..3295941 + 66 NuclAT_42 - -
- (3295876) 3295876..3295941 + 66 NuclAT_42 - -
- (3295876) 3295876..3295941 + 66 NuclAT_42 - -
- (3295876) 3295876..3295941 + 66 NuclAT_42 - -
I6K19_RS15735 (3296254) 3296254..3296361 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (3296414) 3296414..3296475 + 62 NuclAT_27 - -
- (3296414) 3296414..3296475 + 62 NuclAT_27 - -
- (3296414) 3296414..3296475 + 62 NuclAT_27 - -
- (3296414) 3296414..3296475 + 62 NuclAT_27 - -
- (3296414) 3296414..3296475 + 62 NuclAT_29 - -
- (3296414) 3296414..3296475 + 62 NuclAT_29 - -
- (3296414) 3296414..3296475 + 62 NuclAT_29 - -
- (3296414) 3296414..3296475 + 62 NuclAT_29 - -
- (3296414) 3296414..3296475 + 62 NuclAT_31 - -
- (3296414) 3296414..3296475 + 62 NuclAT_31 - -
- (3296414) 3296414..3296475 + 62 NuclAT_31 - -
- (3296414) 3296414..3296475 + 62 NuclAT_31 - -
- (3296414) 3296414..3296475 + 62 NuclAT_33 - -
- (3296414) 3296414..3296475 + 62 NuclAT_33 - -
- (3296414) 3296414..3296475 + 62 NuclAT_33 - -
- (3296414) 3296414..3296475 + 62 NuclAT_33 - -
- (3296414) 3296414..3296475 + 62 NuclAT_35 - -
- (3296414) 3296414..3296475 + 62 NuclAT_35 - -
- (3296414) 3296414..3296475 + 62 NuclAT_35 - -
- (3296414) 3296414..3296475 + 62 NuclAT_35 - -
- (3296414) 3296414..3296475 + 62 NuclAT_37 - -
- (3296414) 3296414..3296475 + 62 NuclAT_37 - -
- (3296414) 3296414..3296475 + 62 NuclAT_37 - -
- (3296414) 3296414..3296475 + 62 NuclAT_37 - -
- (3296414) 3296414..3296476 + 63 NuclAT_16 - -
- (3296414) 3296414..3296476 + 63 NuclAT_16 - -
- (3296414) 3296414..3296476 + 63 NuclAT_16 - -
- (3296414) 3296414..3296476 + 63 NuclAT_16 - -
- (3296414) 3296414..3296476 + 63 NuclAT_18 - -
- (3296414) 3296414..3296476 + 63 NuclAT_18 - -
- (3296414) 3296414..3296476 + 63 NuclAT_18 - -
- (3296414) 3296414..3296476 + 63 NuclAT_18 - -
- (3296414) 3296414..3296476 + 63 NuclAT_20 - -
- (3296414) 3296414..3296476 + 63 NuclAT_20 - -
- (3296414) 3296414..3296476 + 63 NuclAT_20 - -
- (3296414) 3296414..3296476 + 63 NuclAT_20 - -
- (3296414) 3296414..3296476 + 63 NuclAT_22 - -
- (3296414) 3296414..3296476 + 63 NuclAT_22 - -
- (3296414) 3296414..3296476 + 63 NuclAT_22 - -
- (3296414) 3296414..3296476 + 63 NuclAT_22 - -
- (3296414) 3296414..3296476 + 63 NuclAT_24 - -
- (3296414) 3296414..3296476 + 63 NuclAT_24 - -
- (3296414) 3296414..3296476 + 63 NuclAT_24 - -
- (3296414) 3296414..3296476 + 63 NuclAT_24 - -
- (3296414) 3296414..3296476 + 63 NuclAT_26 - -
- (3296414) 3296414..3296476 + 63 NuclAT_26 - -
- (3296414) 3296414..3296476 + 63 NuclAT_26 - -
- (3296414) 3296414..3296476 + 63 NuclAT_26 - -
- (3296414) 3296414..3296477 + 64 NuclAT_39 - -
- (3296414) 3296414..3296477 + 64 NuclAT_39 - -
- (3296414) 3296414..3296477 + 64 NuclAT_39 - -
- (3296414) 3296414..3296477 + 64 NuclAT_39 - -
- (3296414) 3296414..3296477 + 64 NuclAT_41 - -
- (3296414) 3296414..3296477 + 64 NuclAT_41 - -
- (3296414) 3296414..3296477 + 64 NuclAT_41 - -
- (3296414) 3296414..3296477 + 64 NuclAT_41 - -
I6K19_RS15740 (3296767) 3296767..3297867 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
I6K19_RS15745 (3298137) 3298137..3298367 + 231 WP_001146444.1 putative cation transport regulator ChaB -
I6K19_RS15750 (3298525) 3298525..3299220 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
I6K19_RS15755 (3299264) 3299264..3299617 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T192011 WP_000170965.1 NZ_CP069882:c3295826-3295719 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T192011 NZ_CP092037:c2749909-2749502 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCTGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA

Antitoxin


Download         Length: 67 bp

>AT192011 NZ_CP069882:3295874-3295940 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029


Antitoxin

Download structure file

References