Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | ldrD-agrB/Ldr(toxin) |
Location | 3295719..3295940 | Replicon | chromosome |
Accession | NZ_CP069882 | ||
Organism | Escherichia coli strain FDAARGOS_1289 |
Toxin (Protein)
Gene name | ldrD | Uniprot ID | B7LGX8 |
Locus tag | I6K19_RS15730 | Protein ID | WP_000170965.1 |
Coordinates | 3295719..3295826 (-) | Length | 36 a.a. |
Antitoxin (RNA)
Gene name | agrB | ||
Locus tag | - | ||
Coordinates | 3295874..3295940 (+) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
I6K19_RS15705 (3291564) | 3291564..3292646 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
I6K19_RS15710 (3292646) | 3292646..3293479 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
I6K19_RS15715 (3293476) | 3293476..3293868 | + | 393 | WP_000151883.1 | invasion regulator SirB2 | - |
I6K19_RS15720 (3293872) | 3293872..3294681 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
I6K19_RS15725 (3294717) | 3294717..3295571 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
I6K19_RS15730 (3295719) | 3295719..3295826 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_28 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_28 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_28 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_28 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_30 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_30 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_30 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_30 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_32 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_32 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_32 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_32 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_34 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_34 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_34 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_34 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_36 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_36 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_36 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_36 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_38 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_38 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_38 | - | - |
- (3295876) | 3295876..3295939 | + | 64 | NuclAT_38 | - | - |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_15 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_15 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_15 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_15 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_17 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_17 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_17 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_17 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_19 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_19 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_19 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_19 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_21 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_21 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_21 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_21 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_23 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_23 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_23 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_23 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_25 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_25 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_25 | - | Antitoxin |
- (3295874) | 3295874..3295940 | + | 67 | NuclAT_25 | - | Antitoxin |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_40 | - | - |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_40 | - | - |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_40 | - | - |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_40 | - | - |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_42 | - | - |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_42 | - | - |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_42 | - | - |
- (3295876) | 3295876..3295941 | + | 66 | NuclAT_42 | - | - |
I6K19_RS15735 (3296254) | 3296254..3296361 | - | 108 | WP_000170955.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_27 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_27 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_27 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_27 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_29 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_29 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_29 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_29 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_31 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_31 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_31 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_31 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_33 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_33 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_33 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_33 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_35 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_35 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_35 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_35 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_37 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_37 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_37 | - | - |
- (3296414) | 3296414..3296475 | + | 62 | NuclAT_37 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_16 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_16 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_16 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_16 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_18 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_18 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_18 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_18 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_20 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_20 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_20 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_20 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_22 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_22 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_22 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_22 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_24 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_24 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_24 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_24 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_26 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_26 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_26 | - | - |
- (3296414) | 3296414..3296476 | + | 63 | NuclAT_26 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_39 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_39 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_39 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_39 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_41 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_41 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_41 | - | - |
- (3296414) | 3296414..3296477 | + | 64 | NuclAT_41 | - | - |
I6K19_RS15740 (3296767) | 3296767..3297867 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
I6K19_RS15745 (3298137) | 3298137..3298367 | + | 231 | WP_001146444.1 | putative cation transport regulator ChaB | - |
I6K19_RS15750 (3298525) | 3298525..3299220 | + | 696 | WP_001295621.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
I6K19_RS15755 (3299264) | 3299264..3299617 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4001.77 Da Isoelectric Point: 11.4779
>T192011 WP_000170965.1 NZ_CP069882:c3295826-3295719 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T192011 NZ_CP092037:c2749909-2749502 [Escherichia coli]
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCTGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA
GTGGTCCTGTGGCAATCTGATTTGCGCGTCTCCTGGCGCGCACAGTGGCTTTCCTTGCTGATTCATGGGCTGGTTGCCGC
TGTTATTTTACTCATGCCCTGGCCACTCAGTTACACCCCGTTATGGATGGTGTTACTTTCGCTGGTGGTGTTTGATTGCG
TTCGCAGCCAGCGGCGTATTAATGCTCGCCAGGGGGAAATTCGCTTGTTGATGGACGGGCGTTTGCGTTGGCAAGGGCAG
GAGTGGAGCATCGTCAAAGCACCGTGGATGATTAAGAGCGGCATGATGCTGCGTTTACGTTCTGATGGCGGTAAACGGCA
ACATTTATGGCTGGCAGCCGACAGCATGGACGAAGCTGAATGGCGGGATTTACGGCGGATTTTGTTGCAACAAGAGACGC
AAAGATAA
Antitoxin
Download Length: 67 bp
>AT192011 NZ_CP069882:3295874-3295940 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|