Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4656959..4657181 Replicon chromosome
Accession NZ_CP069386
Organism Escherichia coli strain XH1815

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag JSW75_RS22595 Protein ID WP_000170955.1
Coordinates 4656959..4657066 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4657114..4657181 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JSW75_RS22565 (4652815) 4652815..4653648 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
JSW75_RS22570 (4653645) 4653645..4654037 + 393 WP_000200374.1 invasion regulator SirB2 -
JSW75_RS22575 (4654041) 4654041..4654850 + 810 WP_001257044.1 invasion regulator SirB1 -
JSW75_RS22580 (4654886) 4654886..4655740 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JSW75_RS22585 (4655889) 4655889..4655996 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4656044) 4656044..4656110 + 67 NuclAT_34 - -
- (4656044) 4656044..4656110 + 67 NuclAT_34 - -
- (4656044) 4656044..4656110 + 67 NuclAT_34 - -
- (4656044) 4656044..4656110 + 67 NuclAT_34 - -
- (4656044) 4656044..4656110 + 67 NuclAT_36 - -
- (4656044) 4656044..4656110 + 67 NuclAT_36 - -
- (4656044) 4656044..4656110 + 67 NuclAT_36 - -
- (4656044) 4656044..4656110 + 67 NuclAT_36 - -
- (4656044) 4656044..4656110 + 67 NuclAT_38 - -
- (4656044) 4656044..4656110 + 67 NuclAT_38 - -
- (4656044) 4656044..4656110 + 67 NuclAT_38 - -
- (4656044) 4656044..4656110 + 67 NuclAT_38 - -
- (4656044) 4656044..4656110 + 67 NuclAT_40 - -
- (4656044) 4656044..4656110 + 67 NuclAT_40 - -
- (4656044) 4656044..4656110 + 67 NuclAT_40 - -
- (4656044) 4656044..4656110 + 67 NuclAT_40 - -
- (4656044) 4656044..4656110 + 67 NuclAT_42 - -
- (4656044) 4656044..4656110 + 67 NuclAT_42 - -
- (4656044) 4656044..4656110 + 67 NuclAT_42 - -
- (4656044) 4656044..4656110 + 67 NuclAT_42 - -
- (4656044) 4656044..4656110 + 67 NuclAT_44 - -
- (4656044) 4656044..4656110 + 67 NuclAT_44 - -
- (4656044) 4656044..4656110 + 67 NuclAT_44 - -
- (4656044) 4656044..4656110 + 67 NuclAT_44 - -
- (4656046) 4656046..4656111 + 66 NuclAT_18 - -
- (4656046) 4656046..4656111 + 66 NuclAT_18 - -
- (4656046) 4656046..4656111 + 66 NuclAT_18 - -
- (4656046) 4656046..4656111 + 66 NuclAT_18 - -
- (4656046) 4656046..4656111 + 66 NuclAT_21 - -
- (4656046) 4656046..4656111 + 66 NuclAT_21 - -
- (4656046) 4656046..4656111 + 66 NuclAT_21 - -
- (4656046) 4656046..4656111 + 66 NuclAT_21 - -
- (4656046) 4656046..4656111 + 66 NuclAT_24 - -
- (4656046) 4656046..4656111 + 66 NuclAT_24 - -
- (4656046) 4656046..4656111 + 66 NuclAT_24 - -
- (4656046) 4656046..4656111 + 66 NuclAT_24 - -
- (4656046) 4656046..4656111 + 66 NuclAT_27 - -
- (4656046) 4656046..4656111 + 66 NuclAT_27 - -
- (4656046) 4656046..4656111 + 66 NuclAT_27 - -
- (4656046) 4656046..4656111 + 66 NuclAT_27 - -
- (4656046) 4656046..4656111 + 66 NuclAT_30 - -
- (4656046) 4656046..4656111 + 66 NuclAT_30 - -
- (4656046) 4656046..4656111 + 66 NuclAT_30 - -
- (4656046) 4656046..4656111 + 66 NuclAT_30 - -
- (4656046) 4656046..4656111 + 66 NuclAT_33 - -
- (4656046) 4656046..4656111 + 66 NuclAT_33 - -
- (4656046) 4656046..4656111 + 66 NuclAT_33 - -
- (4656046) 4656046..4656111 + 66 NuclAT_33 - -
JSW75_RS22590 (4656424) 4656424..4656531 - 108 WP_000170963.1 type I toxin-antitoxin system toxin Ldr family protein -
- (4656580) 4656580..4656645 + 66 NuclAT_35 - -
- (4656580) 4656580..4656645 + 66 NuclAT_35 - -
- (4656580) 4656580..4656645 + 66 NuclAT_35 - -
- (4656580) 4656580..4656645 + 66 NuclAT_35 - -
- (4656580) 4656580..4656645 + 66 NuclAT_37 - -
- (4656580) 4656580..4656645 + 66 NuclAT_37 - -
- (4656580) 4656580..4656645 + 66 NuclAT_37 - -
- (4656580) 4656580..4656645 + 66 NuclAT_37 - -
- (4656580) 4656580..4656645 + 66 NuclAT_39 - -
- (4656580) 4656580..4656645 + 66 NuclAT_39 - -
- (4656580) 4656580..4656645 + 66 NuclAT_39 - -
- (4656580) 4656580..4656645 + 66 NuclAT_39 - -
- (4656580) 4656580..4656645 + 66 NuclAT_41 - -
- (4656580) 4656580..4656645 + 66 NuclAT_41 - -
- (4656580) 4656580..4656645 + 66 NuclAT_41 - -
- (4656580) 4656580..4656645 + 66 NuclAT_41 - -
- (4656580) 4656580..4656645 + 66 NuclAT_43 - -
- (4656580) 4656580..4656645 + 66 NuclAT_43 - -
- (4656580) 4656580..4656645 + 66 NuclAT_43 - -
- (4656580) 4656580..4656645 + 66 NuclAT_43 - -
- (4656580) 4656580..4656645 + 66 NuclAT_45 - -
- (4656580) 4656580..4656645 + 66 NuclAT_45 - -
- (4656580) 4656580..4656645 + 66 NuclAT_45 - -
- (4656580) 4656580..4656645 + 66 NuclAT_45 - -
- (4656579) 4656579..4656646 + 68 NuclAT_17 - -
- (4656579) 4656579..4656646 + 68 NuclAT_17 - -
- (4656579) 4656579..4656646 + 68 NuclAT_17 - -
- (4656579) 4656579..4656646 + 68 NuclAT_17 - -
- (4656579) 4656579..4656646 + 68 NuclAT_20 - -
- (4656579) 4656579..4656646 + 68 NuclAT_20 - -
- (4656579) 4656579..4656646 + 68 NuclAT_20 - -
- (4656579) 4656579..4656646 + 68 NuclAT_20 - -
- (4656579) 4656579..4656646 + 68 NuclAT_23 - -
- (4656579) 4656579..4656646 + 68 NuclAT_23 - -
- (4656579) 4656579..4656646 + 68 NuclAT_23 - -
- (4656579) 4656579..4656646 + 68 NuclAT_23 - -
- (4656579) 4656579..4656646 + 68 NuclAT_26 - -
- (4656579) 4656579..4656646 + 68 NuclAT_26 - -
- (4656579) 4656579..4656646 + 68 NuclAT_26 - -
- (4656579) 4656579..4656646 + 68 NuclAT_26 - -
- (4656579) 4656579..4656646 + 68 NuclAT_29 - -
- (4656579) 4656579..4656646 + 68 NuclAT_29 - -
- (4656579) 4656579..4656646 + 68 NuclAT_29 - -
- (4656579) 4656579..4656646 + 68 NuclAT_29 - -
- (4656579) 4656579..4656646 + 68 NuclAT_32 - -
- (4656579) 4656579..4656646 + 68 NuclAT_32 - -
- (4656579) 4656579..4656646 + 68 NuclAT_32 - -
- (4656579) 4656579..4656646 + 68 NuclAT_32 - -
JSW75_RS22595 (4656959) 4656959..4657066 - 108 WP_000170955.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (4657114) 4657114..4657181 + 68 NuclAT_16 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_16 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_16 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_16 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_19 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_19 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_19 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_19 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_22 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_22 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_22 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_22 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_25 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_25 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_25 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_25 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_28 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_28 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_28 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_28 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_31 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_31 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_31 - Antitoxin
- (4657114) 4657114..4657181 + 68 NuclAT_31 - Antitoxin
JSW75_RS22600 (4657470) 4657470..4658570 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
JSW75_RS22605 (4658840) 4658840..4659070 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JSW75_RS22610 (4659228) 4659228..4659923 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
JSW75_RS22615 (4659967) 4659967..4660320 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
JSW75_RS22620 (4660505) 4660505..4661899 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T190330 WP_000170955.1 NZ_CP069386:c4657066-4656959 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T190330 NZ_CP091281:c1967079-1966729 [Macrococcus canis]
ATGAAACGTGGAGATGTTTATTTAGCTGATCTGTCACCAGTGAAGGGGTCTGAACAAGGCGGTAAACGCCCCGTCGTTAT
TATTCAGAATAATATTGGGAATAAACATAGTCCTACAGTGATTGTAGCCGCAATTACAGCAAAGATTAATAAGGCAAAGA
TCCCCACCCATGTGGAAATTGGCAAGACCACGCATCACCTGGAAAAGGATTCGGTAATATTGCTTGAACAAATTAGAACT
ATTGATAAGAATAGGTTAATTGATCATCTGACAGTGCTTGATAAGGCAAAGATGAAAGAAGTGGATGTGGCACTTTTAAT
TAGTTTAGGGTTATCAATCGATAGTGAATAG

Antitoxin


Download         Length: 68 bp

>AT190330 NZ_CP069386:4657114-4657181 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References