Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1265690..1265912 Replicon chromosome
Accession NZ_CP069132
Organism Escherichia coli BW25113 substr. CHXR1G20

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag JQK35_RS06190 Protein ID WP_000170955.1
Coordinates 1265690..1265797 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1265845..1265912 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
JQK35_RS06160 1261546..1262379 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
JQK35_RS06165 1262376..1262768 + 393 WP_000200374.1 invasion regulator SirB2 -
JQK35_RS06170 1262772..1263581 + 810 WP_001257044.1 invasion regulator SirB1 -
JQK35_RS06175 1263617..1264471 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
JQK35_RS06180 1264620..1264727 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1264775..1264841 + 67 NuclAT_34 - -
- 1264775..1264841 + 67 NuclAT_34 - -
- 1264775..1264841 + 67 NuclAT_34 - -
- 1264775..1264841 + 67 NuclAT_34 - -
- 1264775..1264841 + 67 NuclAT_36 - -
- 1264775..1264841 + 67 NuclAT_36 - -
- 1264775..1264841 + 67 NuclAT_36 - -
- 1264775..1264841 + 67 NuclAT_36 - -
- 1264775..1264841 + 67 NuclAT_38 - -
- 1264775..1264841 + 67 NuclAT_38 - -
- 1264775..1264841 + 67 NuclAT_38 - -
- 1264775..1264841 + 67 NuclAT_38 - -
- 1264775..1264841 + 67 NuclAT_40 - -
- 1264775..1264841 + 67 NuclAT_40 - -
- 1264775..1264841 + 67 NuclAT_40 - -
- 1264775..1264841 + 67 NuclAT_40 - -
- 1264775..1264841 + 67 NuclAT_42 - -
- 1264775..1264841 + 67 NuclAT_42 - -
- 1264775..1264841 + 67 NuclAT_42 - -
- 1264775..1264841 + 67 NuclAT_42 - -
- 1264775..1264841 + 67 NuclAT_44 - -
- 1264775..1264841 + 67 NuclAT_44 - -
- 1264775..1264841 + 67 NuclAT_44 - -
- 1264775..1264841 + 67 NuclAT_44 - -
- 1264777..1264842 + 66 NuclAT_18 - -
- 1264777..1264842 + 66 NuclAT_18 - -
- 1264777..1264842 + 66 NuclAT_18 - -
- 1264777..1264842 + 66 NuclAT_18 - -
- 1264777..1264842 + 66 NuclAT_21 - -
- 1264777..1264842 + 66 NuclAT_21 - -
- 1264777..1264842 + 66 NuclAT_21 - -
- 1264777..1264842 + 66 NuclAT_21 - -
- 1264777..1264842 + 66 NuclAT_24 - -
- 1264777..1264842 + 66 NuclAT_24 - -
- 1264777..1264842 + 66 NuclAT_24 - -
- 1264777..1264842 + 66 NuclAT_24 - -
- 1264777..1264842 + 66 NuclAT_27 - -
- 1264777..1264842 + 66 NuclAT_27 - -
- 1264777..1264842 + 66 NuclAT_27 - -
- 1264777..1264842 + 66 NuclAT_27 - -
- 1264777..1264842 + 66 NuclAT_30 - -
- 1264777..1264842 + 66 NuclAT_30 - -
- 1264777..1264842 + 66 NuclAT_30 - -
- 1264777..1264842 + 66 NuclAT_30 - -
- 1264777..1264842 + 66 NuclAT_33 - -
- 1264777..1264842 + 66 NuclAT_33 - -
- 1264777..1264842 + 66 NuclAT_33 - -
- 1264777..1264842 + 66 NuclAT_33 - -
JQK35_RS06185 1265155..1265262 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 1265310..1265377 + 68 NuclAT_17 - -
- 1265310..1265377 + 68 NuclAT_17 - -
- 1265310..1265377 + 68 NuclAT_17 - -
- 1265310..1265377 + 68 NuclAT_17 - -
- 1265310..1265377 + 68 NuclAT_20 - -
- 1265310..1265377 + 68 NuclAT_20 - -
- 1265310..1265377 + 68 NuclAT_20 - -
- 1265310..1265377 + 68 NuclAT_20 - -
- 1265310..1265377 + 68 NuclAT_23 - -
- 1265310..1265377 + 68 NuclAT_23 - -
- 1265310..1265377 + 68 NuclAT_23 - -
- 1265310..1265377 + 68 NuclAT_23 - -
- 1265310..1265377 + 68 NuclAT_26 - -
- 1265310..1265377 + 68 NuclAT_26 - -
- 1265310..1265377 + 68 NuclAT_26 - -
- 1265310..1265377 + 68 NuclAT_26 - -
- 1265310..1265377 + 68 NuclAT_29 - -
- 1265310..1265377 + 68 NuclAT_29 - -
- 1265310..1265377 + 68 NuclAT_29 - -
- 1265310..1265377 + 68 NuclAT_29 - -
- 1265310..1265377 + 68 NuclAT_32 - -
- 1265310..1265377 + 68 NuclAT_32 - -
- 1265310..1265377 + 68 NuclAT_32 - -
- 1265310..1265377 + 68 NuclAT_32 - -
- 1265311..1265376 + 66 NuclAT_35 - -
- 1265311..1265376 + 66 NuclAT_35 - -
- 1265311..1265376 + 66 NuclAT_35 - -
- 1265311..1265376 + 66 NuclAT_35 - -
- 1265311..1265376 + 66 NuclAT_37 - -
- 1265311..1265376 + 66 NuclAT_37 - -
- 1265311..1265376 + 66 NuclAT_37 - -
- 1265311..1265376 + 66 NuclAT_37 - -
- 1265311..1265376 + 66 NuclAT_39 - -
- 1265311..1265376 + 66 NuclAT_39 - -
- 1265311..1265376 + 66 NuclAT_39 - -
- 1265311..1265376 + 66 NuclAT_39 - -
- 1265311..1265376 + 66 NuclAT_41 - -
- 1265311..1265376 + 66 NuclAT_41 - -
- 1265311..1265376 + 66 NuclAT_41 - -
- 1265311..1265376 + 66 NuclAT_41 - -
- 1265311..1265376 + 66 NuclAT_43 - -
- 1265311..1265376 + 66 NuclAT_43 - -
- 1265311..1265376 + 66 NuclAT_43 - -
- 1265311..1265376 + 66 NuclAT_43 - -
- 1265311..1265376 + 66 NuclAT_45 - -
- 1265311..1265376 + 66 NuclAT_45 - -
- 1265311..1265376 + 66 NuclAT_45 - -
- 1265311..1265376 + 66 NuclAT_45 - -
JQK35_RS06190 1265690..1265797 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 1265845..1265912 + 68 NuclAT_16 - Antitoxin
- 1265845..1265912 + 68 NuclAT_16 - Antitoxin
- 1265845..1265912 + 68 NuclAT_16 - Antitoxin
- 1265845..1265912 + 68 NuclAT_16 - Antitoxin
- 1265845..1265912 + 68 NuclAT_19 - Antitoxin
- 1265845..1265912 + 68 NuclAT_19 - Antitoxin
- 1265845..1265912 + 68 NuclAT_19 - Antitoxin
- 1265845..1265912 + 68 NuclAT_19 - Antitoxin
- 1265845..1265912 + 68 NuclAT_22 - Antitoxin
- 1265845..1265912 + 68 NuclAT_22 - Antitoxin
- 1265845..1265912 + 68 NuclAT_22 - Antitoxin
- 1265845..1265912 + 68 NuclAT_22 - Antitoxin
- 1265845..1265912 + 68 NuclAT_25 - Antitoxin
- 1265845..1265912 + 68 NuclAT_25 - Antitoxin
- 1265845..1265912 + 68 NuclAT_25 - Antitoxin
- 1265845..1265912 + 68 NuclAT_25 - Antitoxin
- 1265845..1265912 + 68 NuclAT_28 - Antitoxin
- 1265845..1265912 + 68 NuclAT_28 - Antitoxin
- 1265845..1265912 + 68 NuclAT_28 - Antitoxin
- 1265845..1265912 + 68 NuclAT_28 - Antitoxin
- 1265845..1265912 + 68 NuclAT_31 - Antitoxin
- 1265845..1265912 + 68 NuclAT_31 - Antitoxin
- 1265845..1265912 + 68 NuclAT_31 - Antitoxin
- 1265845..1265912 + 68 NuclAT_31 - Antitoxin
JQK35_RS06195 1266201..1267301 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
JQK35_RS06200 1267571..1267801 + 231 WP_001146444.1 putative cation transport regulator ChaB -
JQK35_RS06205 1267959..1268654 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
JQK35_RS06210 1268698..1269051 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
JQK35_RS06215 1269236..1270630 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T189910 WP_000170955.1 NZ_CP069132:c1265797-1265690 [Escherichia coli BW25113]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T189910 NZ_CP091026:784731-785027 [Escherichia coli]
ATGGAAAAACGCACACCACATACACGTTTGAGTCAGGTTAAAAAACTTGTCAATGCCGGGCAAGTTCGTACAACACGTAG
TGCCCTGTTAAATGCAGATGAGTTAGGTTTGGATTTTGATGGTATGTGTAATGTTATCATTGGATTATCAGAGAGCGACT
TTTATAAAAGCATGACCACCTACTCTGATCATACTATCTGGCAGGATGTTTACAGACCCAGGCTTGTTACAGGCCAGGTT
TATCTTAAAATTACGGTAATTCATGACGTACTGATCGTCTCGTTTAAGGAGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT189910 NZ_CP069132:1265845-1265912 [Escherichia coli BW25113]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References