Detailed information of TA system TA188488

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2615491..2615711
• Replicon: chromosome
• Accession: NZ_CP068821
• Organism: Escherichia coli strain RIVM_C029952

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: A0A229AEQ8
• Locus tag: JNN43_RS12580
• Protein ID: WP_000176713.1
• Coordinates: 2615491..2615598 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2615648..2615711 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
JNN43_RS12550	2610625..2611707	+	1083	WP_001550996.1	peptide chain release factor 1	-
JNN43_RS12555	2611707..2612540	+	834	WP_000456570.1	peptide chain release factor N(5)-glutamine methyltransferase	-
JNN43_RS12560	2612537..2612929	+	393	WP_000200377.1	invasion regulator SirB2	-
JNN43_RS12565	2612933..2613742	+	810	WP_001257044.1	invasion regulator SirB1	-
JNN43_RS12570	2613778..2614632	+	855	WP_000811065.1	3-deoxy-8-phosphooctulonate synthase	-
JNN43_RS12575	2614827..2615285	+	459	WP_000526135.1	IS200/IS605 family transposase	-
JNN43_RS12580	2615491..2615598	-	108	WP_000176713.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	2615648..2615711	+	64	NuclAT_38	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_38	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_38	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_38	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_40	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_40	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_40	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_40	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_42	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_42	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_42	-	Antitoxin
-	2615648..2615711	+	64	NuclAT_42	-	Antitoxin
JNN43_RS12585	2616026..2616133	-	108	WP_000170955.1	small toxic polypeptide LdrA/LdrC	-
-	2616181..2616246	+	66	NuclAT_37	-	-
-	2616181..2616246	+	66	NuclAT_37	-	-
-	2616181..2616246	+	66	NuclAT_37	-	-
-	2616181..2616246	+	66	NuclAT_37	-	-
-	2616181..2616246	+	66	NuclAT_39	-	-
-	2616181..2616246	+	66	NuclAT_39	-	-
-	2616181..2616246	+	66	NuclAT_39	-	-
-	2616181..2616246	+	66	NuclAT_39	-	-
-	2616181..2616246	+	66	NuclAT_41	-	-
-	2616181..2616246	+	66	NuclAT_41	-	-
-	2616181..2616246	+	66	NuclAT_41	-	-
-	2616181..2616246	+	66	NuclAT_41	-	-
-	2616181..2616248	+	68	NuclAT_12	-	-
-	2616181..2616248	+	68	NuclAT_12	-	-
-	2616181..2616248	+	68	NuclAT_12	-	-
-	2616181..2616248	+	68	NuclAT_12	-	-
-	2616181..2616248	+	68	NuclAT_13	-	-
-	2616181..2616248	+	68	NuclAT_13	-	-
-	2616181..2616248	+	68	NuclAT_13	-	-
-	2616181..2616248	+	68	NuclAT_13	-	-
-	2616181..2616248	+	68	NuclAT_14	-	-
-	2616181..2616248	+	68	NuclAT_14	-	-
-	2616181..2616248	+	68	NuclAT_14	-	-
-	2616181..2616248	+	68	NuclAT_14	-	-
-	2616181..2616248	+	68	NuclAT_15	-	-
-	2616181..2616248	+	68	NuclAT_15	-	-
-	2616181..2616248	+	68	NuclAT_15	-	-
-	2616181..2616248	+	68	NuclAT_15	-	-
-	2616181..2616248	+	68	NuclAT_16	-	-
-	2616181..2616248	+	68	NuclAT_16	-	-
-	2616181..2616248	+	68	NuclAT_16	-	-
-	2616181..2616248	+	68	NuclAT_16	-	-
-	2616181..2616248	+	68	NuclAT_17	-	-
-	2616181..2616248	+	68	NuclAT_17	-	-
-	2616181..2616248	+	68	NuclAT_17	-	-
-	2616181..2616248	+	68	NuclAT_17	-	-
JNN43_RS12590	2616538..2617638	-	1101	WP_001309461.1	sodium-potassium/proton antiporter ChaA	-
JNN43_RS12595	2617908..2618138	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
JNN43_RS12600	2618296..2618991	+	696	WP_001295621.1	glutathione-specific gamma-glutamylcyclotransferase	-
JNN43_RS12605	2619035..2619388	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	flank	IS/Tn	-	-	2614827..2615285	458

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 4031.79 Da
• Isoelectric Point: 11.4779

>T188488 WP_000176713.1 NZ_CP068821:c2615598-2615491 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Nucleotide

• Length: 108 bp

>T188488 NZ_CP090468:c4793098-4792814 [Klebsiella pneumoniae]
ATGACCTATGAACTGGAGTTTGATCCACGAGCCTGGCGCGAATGGCAGAAGCCTGGCGAGACGGTCAAAAAACAGTTCAA
AAATAAGCTCCAGCAGATTGTGCAGAATCCGCGAATTGAGTCGACCAGGCTGAGCGATTTACCGGATTGCTACAAAATCA
AGCTTAAGGCGTCAGGTTATCGGTTGGTGTATCAAGTACGAGATAGTGTGGTGGTGGTTTACGTTATTGCCATTGGCAAA
AGAGAGAAAGCGGCCGTTTATCATCAGGCGAATAAACGGCTCTAA

Antitoxin

Nucleotide

• Length: 64 bp

>AT188488 NZ_CP068821:2615648-2615711 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCCCTCAACGTGCGGGGGTTTTCT

Structures

Toxin

• AlphaFold DB: A0A229AEQ8

Antitoxin