Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | txpA-SprF3/- |
| Location | 2095456..2095755 | Replicon | chromosome |
| Accession | NZ_CP065857 | ||
| Organism | Staphylococcus aureus strain CC1153-MRSA | ||
Toxin (Protein)
| Gene name | txpA | Uniprot ID | - |
| Locus tag | I1A60_RS10305 | Protein ID | WP_072353918.1 |
| Coordinates | 2095579..2095755 (-) | Length | 59 a.a. |
Antitoxin (RNA)
| Gene name | SprF3 | ||
| Locus tag | - | ||
| Coordinates | 2095456..2095511 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| I1A60_RS10265 | 2091014..2091193 | + | 180 | WP_000669791.1 | hypothetical protein | - |
| I1A60_RS10270 | 2091504..2091764 | + | 261 | WP_001791826.1 | hypothetical protein | - |
| I1A60_RS10275 | 2091817..2092167 | - | 351 | WP_000702263.1 | complement inhibitor SCIN-A | - |
| I1A60_RS10280 | 2092678..2093013 | - | 336 | Protein_1986 | SH3 domain-containing protein | - |
| I1A60_RS10285 | 2093664..2094155 | - | 492 | WP_000920038.1 | staphylokinase | - |
| I1A60_RS10290 | 2094346..2095101 | - | 756 | WP_000861038.1 | CHAP domain-containing protein | - |
| I1A60_RS10295 | 2095113..2095367 | - | 255 | WP_000611512.1 | phage holin | - |
| I1A60_RS10300 | 2095419..2095526 | + | 108 | WP_001791821.1 | hypothetical protein | - |
| - | 2095448..2095587 | + | 140 | NuclAT_0 | - | - |
| - | 2095448..2095587 | + | 140 | NuclAT_0 | - | - |
| - | 2095448..2095587 | + | 140 | NuclAT_0 | - | - |
| - | 2095448..2095587 | + | 140 | NuclAT_0 | - | - |
| - | 2095456..2095511 | + | 56 | - | - | Antitoxin |
| I1A60_RS10305 | 2095579..2095755 | - | 177 | WP_072353918.1 | putative holin-like toxin | Toxin |
| I1A60_RS10310 | 2095898..2096272 | - | 375 | WP_000340977.1 | hypothetical protein | - |
| I1A60_RS10315 | 2096328..2096615 | - | 288 | WP_001262620.1 | hypothetical protein | - |
| I1A60_RS10320 | 2096661..2096813 | - | 153 | WP_001000058.1 | hypothetical protein | - |
| I1A60_RS10325 | 2096806..2097384 | - | 579 | Protein_1995 | structural protein | - |
| I1A60_RS10330 | 2097385..2098197 | + | 813 | Protein_1996 | sphingomyelin phosphodiesterase | - |
| I1A60_RS10335 | 2098435..2099451 | - | 1017 | WP_000595326.1 | bi-component leukocidin LukGH subunit G | - |
| I1A60_RS10340 | 2099473..2100525 | - | 1053 | WP_000791419.1 | bi-component leukocidin LukGH subunit H | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | scn / sak / hlb / groEL | 2091817..2109732 | 17915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 59 a.a. Molecular weight: 6810.43 Da Isoelectric Point: 9.9479
>T183544 WP_072353918.1 NZ_CP065857:c2095755-2095579 [Staphylococcus aureus]
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
MDRWWLSEYKEVVPMLALLKSLERRCLMITISTMLQFGLFLIALIGLVIKLIELSNKK
Download Length: 177 bp
>T183544 NZ_CP087110:1820640-1820743 [Escherichia coli]
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
GGCAAGGCAACTAAGCCTGCATTAATGCCAACTTTTAGCGCACGGCTCTCTCCCAAGAGCCATTTCCCTGGACCGAATAC
AGGAATCGTGTTCGGTCTCTTTTT
Antitoxin
Download Length: 56 bp
>AT183544 NZ_CP065857:2095456-2095511 [Staphylococcus aureus]
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
AAAAAGGGCAACATGCGCAAACATGTTACCCTAATGAGCCCGTTAAAAAGACGGTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|