Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-timR/Ldr(toxin)
Location 4292729..4292949 Replicon chromosome
Accession NZ_CP065624
Organism Escherichia coli strain FDAARGOS_941

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag I6G98_RS22200 Protein ID WP_000170965.1
Coordinates 4292729..4292836 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name timR
Locus tag -
Coordinates 4292884..4292949 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
I6G98_RS22170 4288038..4289120 + 1083 WP_000804726.1 peptide chain release factor 1 -
I6G98_RS22175 4289120..4289953 + 834 WP_032359516.1 peptide chain release factor N(5)-glutamine methyltransferase -
I6G98_RS22180 4289950..4290342 + 393 WP_000200378.1 invasion regulator SirB2 -
I6G98_RS22185 4290346..4291155 + 810 WP_197932824.1 invasion regulator SirB1 -
I6G98_RS22190 4291191..4292045 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
I6G98_RS22195 4292194..4292301 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4292349..4292415 + 67 NuclAT_33 - -
- 4292349..4292415 + 67 NuclAT_33 - -
- 4292349..4292415 + 67 NuclAT_33 - -
- 4292349..4292415 + 67 NuclAT_33 - -
- 4292349..4292415 + 67 NuclAT_34 - -
- 4292349..4292415 + 67 NuclAT_34 - -
- 4292349..4292415 + 67 NuclAT_34 - -
- 4292349..4292415 + 67 NuclAT_34 - -
- 4292349..4292415 + 67 NuclAT_35 - -
- 4292349..4292415 + 67 NuclAT_35 - -
- 4292349..4292415 + 67 NuclAT_35 - -
- 4292349..4292415 + 67 NuclAT_35 - -
- 4292351..4292414 + 64 NuclAT_22 - -
- 4292351..4292414 + 64 NuclAT_22 - -
- 4292351..4292414 + 64 NuclAT_22 - -
- 4292351..4292414 + 64 NuclAT_22 - -
- 4292351..4292414 + 64 NuclAT_24 - -
- 4292351..4292414 + 64 NuclAT_24 - -
- 4292351..4292414 + 64 NuclAT_24 - -
- 4292351..4292414 + 64 NuclAT_24 - -
- 4292351..4292414 + 64 NuclAT_26 - -
- 4292351..4292414 + 64 NuclAT_26 - -
- 4292351..4292414 + 64 NuclAT_26 - -
- 4292351..4292414 + 64 NuclAT_26 - -
- 4292351..4292414 + 64 NuclAT_28 - -
- 4292351..4292414 + 64 NuclAT_28 - -
- 4292351..4292414 + 64 NuclAT_28 - -
- 4292351..4292414 + 64 NuclAT_28 - -
- 4292351..4292414 + 64 NuclAT_30 - -
- 4292351..4292414 + 64 NuclAT_30 - -
- 4292351..4292414 + 64 NuclAT_30 - -
- 4292351..4292414 + 64 NuclAT_30 - -
- 4292351..4292414 + 64 NuclAT_32 - -
- 4292351..4292414 + 64 NuclAT_32 - -
- 4292351..4292414 + 64 NuclAT_32 - -
- 4292351..4292414 + 64 NuclAT_32 - -
I6G98_RS22200 4292729..4292836 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4292884..4292949 + 66 NuclAT_21 - Antitoxin
- 4292884..4292949 + 66 NuclAT_21 - Antitoxin
- 4292884..4292949 + 66 NuclAT_21 - Antitoxin
- 4292884..4292949 + 66 NuclAT_21 - Antitoxin
- 4292884..4292949 + 66 NuclAT_23 - Antitoxin
- 4292884..4292949 + 66 NuclAT_23 - Antitoxin
- 4292884..4292949 + 66 NuclAT_23 - Antitoxin
- 4292884..4292949 + 66 NuclAT_23 - Antitoxin
- 4292884..4292949 + 66 NuclAT_25 - Antitoxin
- 4292884..4292949 + 66 NuclAT_25 - Antitoxin
- 4292884..4292949 + 66 NuclAT_25 - Antitoxin
- 4292884..4292949 + 66 NuclAT_25 - Antitoxin
- 4292884..4292949 + 66 NuclAT_27 - Antitoxin
- 4292884..4292949 + 66 NuclAT_27 - Antitoxin
- 4292884..4292949 + 66 NuclAT_27 - Antitoxin
- 4292884..4292949 + 66 NuclAT_27 - Antitoxin
- 4292884..4292949 + 66 NuclAT_29 - Antitoxin
- 4292884..4292949 + 66 NuclAT_29 - Antitoxin
- 4292884..4292949 + 66 NuclAT_29 - Antitoxin
- 4292884..4292949 + 66 NuclAT_29 - Antitoxin
- 4292884..4292949 + 66 NuclAT_31 - Antitoxin
- 4292884..4292949 + 66 NuclAT_31 - Antitoxin
- 4292884..4292949 + 66 NuclAT_31 - Antitoxin
- 4292884..4292949 + 66 NuclAT_31 - Antitoxin
- 4292884..4292951 + 68 NuclAT_15 - -
- 4292884..4292951 + 68 NuclAT_15 - -
- 4292884..4292951 + 68 NuclAT_15 - -
- 4292884..4292951 + 68 NuclAT_15 - -
- 4292884..4292951 + 68 NuclAT_16 - -
- 4292884..4292951 + 68 NuclAT_16 - -
- 4292884..4292951 + 68 NuclAT_16 - -
- 4292884..4292951 + 68 NuclAT_16 - -
- 4292884..4292951 + 68 NuclAT_17 - -
- 4292884..4292951 + 68 NuclAT_17 - -
- 4292884..4292951 + 68 NuclAT_17 - -
- 4292884..4292951 + 68 NuclAT_17 - -
- 4292884..4292951 + 68 NuclAT_18 - -
- 4292884..4292951 + 68 NuclAT_18 - -
- 4292884..4292951 + 68 NuclAT_18 - -
- 4292884..4292951 + 68 NuclAT_18 - -
- 4292884..4292951 + 68 NuclAT_19 - -
- 4292884..4292951 + 68 NuclAT_19 - -
- 4292884..4292951 + 68 NuclAT_19 - -
- 4292884..4292951 + 68 NuclAT_19 - -
- 4292884..4292951 + 68 NuclAT_20 - -
- 4292884..4292951 + 68 NuclAT_20 - -
- 4292884..4292951 + 68 NuclAT_20 - -
- 4292884..4292951 + 68 NuclAT_20 - -
I6G98_RS22205 4293241..4294341 - 1101 WP_032359515.1 sodium-potassium/proton antiporter ChaA -
I6G98_RS22210 4294611..4294871 + 261 WP_197932825.1 ChaB family protein -
I6G98_RS22215 4295029..4295724 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
I6G98_RS22220 4295768..4296121 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
I6G98_RS22225 4296305..4297699 + 1395 WP_032359513.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T183076 WP_000170965.1 NZ_CP065624:c4292836-4292729 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T183076 NZ_CP086659:964843-965238 [Staphylococcus capitis]
ATGCAAAGCACTAAATATTTAACTGAAAAACAAGTGATTGCCATTAATGTAAAAGCAATACAAGATTTCTCACCAAAAGA
ACAAGTTGGTGTTAAAGTTCCAGAAGTTCTTAATGCTACTATTGAAGGAGTTAAACAATCATTCGGTGGAGTTGAACTAT
ATGAAACAATCGAGAGAAAAGCAGCTTTTATATATAGAAATATAGCTCAAAAGCACGCATTCCATAATGCGAATAAAAGA
ACAGCTTTTACATCTATGGTAATATTTTTGAAGTTAAATAGTATTAATTTTGAATGCACTCAAGATGAAGCGGTTCAGTT
TACTTTAAGAGTAGTAAACGACAAAAATCTTACTCTTGAGGGAATTGAGACATGGATCAAGAGGCATTGTAAATAA

Antitoxin


Download         Length: 66 bp

>AT183076 NZ_CP065624:4292884-4292949 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References