Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2012789..2013010 Replicon chromosome
Accession NZ_CP063518
Organism Escherichia coli strain EH01-18-02

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag IQS16_RS09555 Protein ID WP_000170954.1
Coordinates 2012789..2012896 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2012944..2013010 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
IQS16_RS09530 2008633..2009715 + 1083 WP_000804726.1 peptide chain release factor 1 -
IQS16_RS09535 2009715..2010548 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
IQS16_RS09540 2010545..2010937 + 393 WP_000200378.1 invasion regulator SirB2 -
IQS16_RS09545 2010941..2011750 + 810 WP_001257044.1 invasion regulator SirB1 -
IQS16_RS09550 2011786..2012640 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
IQS16_RS09555 2012789..2012896 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2012944..2013010 + 67 NuclAT_26 - Antitoxin
- 2012944..2013010 + 67 NuclAT_26 - Antitoxin
- 2012944..2013010 + 67 NuclAT_26 - Antitoxin
- 2012944..2013010 + 67 NuclAT_26 - Antitoxin
- 2012944..2013010 + 67 NuclAT_28 - Antitoxin
- 2012944..2013010 + 67 NuclAT_28 - Antitoxin
- 2012944..2013010 + 67 NuclAT_28 - Antitoxin
- 2012944..2013010 + 67 NuclAT_28 - Antitoxin
- 2012944..2013010 + 67 NuclAT_30 - Antitoxin
- 2012944..2013010 + 67 NuclAT_30 - Antitoxin
- 2012944..2013010 + 67 NuclAT_30 - Antitoxin
- 2012944..2013010 + 67 NuclAT_30 - Antitoxin
- 2012944..2013010 + 67 NuclAT_32 - Antitoxin
- 2012944..2013010 + 67 NuclAT_32 - Antitoxin
- 2012944..2013010 + 67 NuclAT_32 - Antitoxin
- 2012944..2013010 + 67 NuclAT_32 - Antitoxin
- 2012944..2013010 + 67 NuclAT_34 - Antitoxin
- 2012944..2013010 + 67 NuclAT_34 - Antitoxin
- 2012944..2013010 + 67 NuclAT_34 - Antitoxin
- 2012944..2013010 + 67 NuclAT_34 - Antitoxin
- 2012944..2013010 + 67 NuclAT_36 - Antitoxin
- 2012944..2013010 + 67 NuclAT_36 - Antitoxin
- 2012944..2013010 + 67 NuclAT_36 - Antitoxin
- 2012944..2013010 + 67 NuclAT_36 - Antitoxin
- 2012946..2013009 + 64 NuclAT_39 - -
- 2012946..2013009 + 64 NuclAT_39 - -
- 2012946..2013009 + 64 NuclAT_39 - -
- 2012946..2013009 + 64 NuclAT_39 - -
- 2012946..2013009 + 64 NuclAT_41 - -
- 2012946..2013009 + 64 NuclAT_41 - -
- 2012946..2013009 + 64 NuclAT_41 - -
- 2012946..2013009 + 64 NuclAT_41 - -
- 2012946..2013009 + 64 NuclAT_43 - -
- 2012946..2013009 + 64 NuclAT_43 - -
- 2012946..2013009 + 64 NuclAT_43 - -
- 2012946..2013009 + 64 NuclAT_43 - -
IQS16_RS09560 2013324..2013431 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2013484..2013545 + 62 NuclAT_38 - -
- 2013484..2013545 + 62 NuclAT_38 - -
- 2013484..2013545 + 62 NuclAT_38 - -
- 2013484..2013545 + 62 NuclAT_38 - -
- 2013484..2013545 + 62 NuclAT_40 - -
- 2013484..2013545 + 62 NuclAT_40 - -
- 2013484..2013545 + 62 NuclAT_40 - -
- 2013484..2013545 + 62 NuclAT_40 - -
- 2013484..2013545 + 62 NuclAT_42 - -
- 2013484..2013545 + 62 NuclAT_42 - -
- 2013484..2013545 + 62 NuclAT_42 - -
- 2013484..2013545 + 62 NuclAT_42 - -
- 2013484..2013546 + 63 NuclAT_27 - -
- 2013484..2013546 + 63 NuclAT_27 - -
- 2013484..2013546 + 63 NuclAT_27 - -
- 2013484..2013546 + 63 NuclAT_27 - -
- 2013484..2013546 + 63 NuclAT_29 - -
- 2013484..2013546 + 63 NuclAT_29 - -
- 2013484..2013546 + 63 NuclAT_29 - -
- 2013484..2013546 + 63 NuclAT_29 - -
- 2013484..2013546 + 63 NuclAT_31 - -
- 2013484..2013546 + 63 NuclAT_31 - -
- 2013484..2013546 + 63 NuclAT_31 - -
- 2013484..2013546 + 63 NuclAT_31 - -
- 2013484..2013546 + 63 NuclAT_33 - -
- 2013484..2013546 + 63 NuclAT_33 - -
- 2013484..2013546 + 63 NuclAT_33 - -
- 2013484..2013546 + 63 NuclAT_33 - -
- 2013484..2013546 + 63 NuclAT_35 - -
- 2013484..2013546 + 63 NuclAT_35 - -
- 2013484..2013546 + 63 NuclAT_35 - -
- 2013484..2013546 + 63 NuclAT_35 - -
- 2013484..2013546 + 63 NuclAT_37 - -
- 2013484..2013546 + 63 NuclAT_37 - -
- 2013484..2013546 + 63 NuclAT_37 - -
- 2013484..2013546 + 63 NuclAT_37 - -
- 2013484..2013547 + 64 NuclAT_15 - -
- 2013484..2013547 + 64 NuclAT_15 - -
- 2013484..2013547 + 64 NuclAT_15 - -
- 2013484..2013547 + 64 NuclAT_15 - -
- 2013484..2013547 + 64 NuclAT_17 - -
- 2013484..2013547 + 64 NuclAT_17 - -
- 2013484..2013547 + 64 NuclAT_17 - -
- 2013484..2013547 + 64 NuclAT_17 - -
- 2013484..2013547 + 64 NuclAT_19 - -
- 2013484..2013547 + 64 NuclAT_19 - -
- 2013484..2013547 + 64 NuclAT_19 - -
- 2013484..2013547 + 64 NuclAT_19 - -
- 2013484..2013547 + 64 NuclAT_21 - -
- 2013484..2013547 + 64 NuclAT_21 - -
- 2013484..2013547 + 64 NuclAT_21 - -
- 2013484..2013547 + 64 NuclAT_21 - -
- 2013484..2013547 + 64 NuclAT_23 - -
- 2013484..2013547 + 64 NuclAT_23 - -
- 2013484..2013547 + 64 NuclAT_23 - -
- 2013484..2013547 + 64 NuclAT_23 - -
- 2013484..2013547 + 64 NuclAT_25 - -
- 2013484..2013547 + 64 NuclAT_25 - -
- 2013484..2013547 + 64 NuclAT_25 - -
- 2013484..2013547 + 64 NuclAT_25 - -
IQS16_RS09565 2013860..2013967 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2014015..2014082 + 68 NuclAT_14 - -
- 2014015..2014082 + 68 NuclAT_14 - -
- 2014015..2014082 + 68 NuclAT_14 - -
- 2014015..2014082 + 68 NuclAT_14 - -
- 2014015..2014082 + 68 NuclAT_16 - -
- 2014015..2014082 + 68 NuclAT_16 - -
- 2014015..2014082 + 68 NuclAT_16 - -
- 2014015..2014082 + 68 NuclAT_16 - -
- 2014015..2014082 + 68 NuclAT_18 - -
- 2014015..2014082 + 68 NuclAT_18 - -
- 2014015..2014082 + 68 NuclAT_18 - -
- 2014015..2014082 + 68 NuclAT_18 - -
- 2014015..2014082 + 68 NuclAT_20 - -
- 2014015..2014082 + 68 NuclAT_20 - -
- 2014015..2014082 + 68 NuclAT_20 - -
- 2014015..2014082 + 68 NuclAT_20 - -
- 2014015..2014082 + 68 NuclAT_22 - -
- 2014015..2014082 + 68 NuclAT_22 - -
- 2014015..2014082 + 68 NuclAT_22 - -
- 2014015..2014082 + 68 NuclAT_22 - -
- 2014015..2014082 + 68 NuclAT_24 - -
- 2014015..2014082 + 68 NuclAT_24 - -
- 2014015..2014082 + 68 NuclAT_24 - -
- 2014015..2014082 + 68 NuclAT_24 - -
IQS16_RS09570 2014372..2015472 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
IQS16_RS09575 2015742..2015972 + 231 WP_001146442.1 putative cation transport regulator ChaB -
IQS16_RS09580 2016130..2016825 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
IQS16_RS09585 2016869..2017222 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T178656 WP_000170954.1 NZ_CP063518:c2012896-2012789 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T178656 NZ_CP084207:c338739-338566 [Escherichia coli]
ATGGCACTATTCTCTAAAATATTAATTTTTTATGTGATTGGTGTGAACATATCCTTTGTCATTATCTGGTTTATCTCACA
TGAGAAAACACATATTCGTTTACTTAGTGCATTCCTGGTCGGAATAACCTGGCCAATGAGTCTGCCTGTGGCATTACTTT
TTTCTCTCTTTTAG

Antitoxin


Download         Length: 67 bp

>AT178656 NZ_CP063518:2012944-2013010 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References