Detailed information of TA system TA176060

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-rdlD/Ldr(toxin)
• Location: 2602158..2602372
• Replicon: chromosome
• Accession: NZ_CP062744
• Organism: Escherichia coli O157:H7 strain Z1615

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: J7R083
• Locus tag: ILQ43_RS13230
• Protein ID: WP_000170963.1
• Coordinates: 2602158..2602265 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	rdlD
Locus tag	-
Coordinates	2602313..2602372 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
ILQ43_RS13200	2597467..2598549	+	1083	WP_000804726.1	peptide chain release factor 1	-
ILQ43_RS13205	2598549..2599382	+	834	WP_000456466.1	peptide chain release factor N(5)-glutamine methyltransferase	-
ILQ43_RS13210	2599379..2599771	+	393	WP_000200380.1	invasion regulator SirB2	-
ILQ43_RS13215	2599775..2600584	+	810	WP_001257044.1	invasion regulator SirB1	-
ILQ43_RS13220	2600620..2601474	+	855	WP_000811067.1	3-deoxy-8-phosphooctulonate synthase	-
ILQ43_RS13225	2601622..2601729	-	108	WP_000170954.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	2601782..2601843	+	62	NuclAT_24	-	-
-	2601782..2601843	+	62	NuclAT_24	-	-
-	2601782..2601843	+	62	NuclAT_24	-	-
-	2601782..2601843	+	62	NuclAT_24	-	-
-	2601782..2601843	+	62	NuclAT_26	-	-
-	2601782..2601843	+	62	NuclAT_26	-	-
-	2601782..2601843	+	62	NuclAT_26	-	-
-	2601782..2601843	+	62	NuclAT_26	-	-
-	2601782..2601843	+	62	NuclAT_28	-	-
-	2601782..2601843	+	62	NuclAT_28	-	-
-	2601782..2601843	+	62	NuclAT_28	-	-
-	2601782..2601843	+	62	NuclAT_28	-	-
-	2601782..2601843	+	62	NuclAT_30	-	-
-	2601782..2601843	+	62	NuclAT_30	-	-
-	2601782..2601843	+	62	NuclAT_30	-	-
-	2601782..2601843	+	62	NuclAT_30	-	-
-	2601782..2601843	+	62	NuclAT_32	-	-
-	2601782..2601843	+	62	NuclAT_32	-	-
-	2601782..2601843	+	62	NuclAT_32	-	-
-	2601782..2601843	+	62	NuclAT_32	-	-
-	2601782..2601844	+	63	NuclAT_17	-	-
-	2601782..2601844	+	63	NuclAT_17	-	-
-	2601782..2601844	+	63	NuclAT_17	-	-
-	2601782..2601844	+	63	NuclAT_17	-	-
-	2601782..2601844	+	63	NuclAT_18	-	-
-	2601782..2601844	+	63	NuclAT_18	-	-
-	2601782..2601844	+	63	NuclAT_18	-	-
-	2601782..2601844	+	63	NuclAT_18	-	-
-	2601782..2601844	+	63	NuclAT_19	-	-
-	2601782..2601844	+	63	NuclAT_19	-	-
-	2601782..2601844	+	63	NuclAT_19	-	-
-	2601782..2601844	+	63	NuclAT_19	-	-
-	2601782..2601844	+	63	NuclAT_20	-	-
-	2601782..2601844	+	63	NuclAT_20	-	-
-	2601782..2601844	+	63	NuclAT_20	-	-
-	2601782..2601844	+	63	NuclAT_20	-	-
-	2601782..2601844	+	63	NuclAT_22	-	-
-	2601782..2601844	+	63	NuclAT_22	-	-
-	2601782..2601844	+	63	NuclAT_22	-	-
-	2601782..2601844	+	63	NuclAT_22	-	-
-	2601782..2601844	+	63	NuclAT_23	-	-
-	2601782..2601844	+	63	NuclAT_23	-	-
-	2601782..2601844	+	63	NuclAT_23	-	-
-	2601782..2601844	+	63	NuclAT_23	-	-
ILQ43_RS13230	2602158..2602265	-	108	WP_000170963.1	small toxic polypeptide LdrB	Toxin
-	2602313..2602372	+	60	NuclAT_25	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_25	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_25	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_25	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_27	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_27	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_27	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_27	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_29	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_29	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_29	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_29	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_31	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_31	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_31	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_31	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_33	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_33	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_33	-	Antitoxin
-	2602313..2602372	+	60	NuclAT_33	-	Antitoxin
ILQ43_RS13235	2602664..2603764	-	1101	WP_001301956.1	sodium-potassium/proton antiporter ChaA	-
ILQ43_RS13240	2604034..2604264	+	231	WP_001146444.1	putative cation transport regulator ChaB	-
ILQ43_RS13245	2604425..2605120	+	696	WP_001301489.1	glutathione-specific gamma-glutamylcyclotransferase	-
ILQ43_RS13250	2605164..2605517	-	354	WP_001169669.1	DsrE/F sulfur relay family protein YchN	-
ILQ43_RS13255	2605703..2607097	+	1395	WP_000086192.1	inverse autotransporter invasin YchO	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3971.74 Da
• Isoelectric Point: 11.4779

>T176060 WP_000170963.1 NZ_CP062744:c2602265-2602158 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Nucleotide

• Length: 108 bp

>T176060 NZ_CP082349:1373241-1373639 [Escherichia coli]
ATGCTGAAATTCATGCTGGATACCAATATCTGTATTTTCACTATTAAGAATAAACCAGTACATGTCAGAGAGCGGTTTAA
CCTGAATTCTGGCCGGATGTGTATAAGTTCTGTAACATTGATGGAGCTTATCTATGGGGCAGAAAAAAGTCAGATGCCAG
AACGCAATTTGGCGGTGATTGAAGGTTTCGTATCTCGTTTGGAAGTGCTTGATTATGATAGTGCTGCTGCGACGCATACC
GGGCAAATCAGGGCCGAGCTTGCCCGGCAGGGAAGGCCTGTTGGACCTTTTGACCAGATGATAGCGGGACATGCTCGCAG
TCGCGGTTTGATTGTGGTTACCAACAATACCCGAGAGTTTGAGCGAGTGGCGGGAATCAGACTAGAAGATTGGAGCTAA

Antitoxin

Nucleotide

• Length: 60 bp

>AT176060 NZ_CP062744:2602313-2602372 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Structures

Antitoxin