Detailed information of TA system TA165302

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokC/Ldr(toxin)
• Location: 4118723..4118942
• Replicon: chromosome
• Accession: NZ_CP057458
• Organism: Escherichia fergusonii strain RHB26-C09

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: -
• Locus tag: HVY30_RS19865
• Protein ID: WP_114091462.1
• Coordinates: 4118723..4118830 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokC
Locus tag	-
Coordinates	4118888..4118942 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HVY30_RS19840	4113959..4114726	-	768	WP_000279501.1	cellulose biosynthesis protein BcsQ	-
HVY30_RS19845	4114738..4114926	-	189	WP_001063310.1	YhjR family protein	-
HVY30_RS19850	4115213..4116772	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HVY30_RS19855	4116769..4116960	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HVY30_RS19860	4116957..4118636	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HVY30_RS19865	4118723..4118830	-	108	WP_114091462.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4118888..4118942	+	55	NuclAT_20	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_20	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_20	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_20	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_23	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_23	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_23	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_23	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_26	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_26	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_26	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_26	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_29	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_29	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_29	-	Antitoxin
-	4118888..4118942	+	55	NuclAT_29	-	Antitoxin
-	4118888..4118944	+	57	NuclAT_14	-	-
-	4118888..4118944	+	57	NuclAT_14	-	-
-	4118888..4118944	+	57	NuclAT_14	-	-
-	4118888..4118944	+	57	NuclAT_14	-	-
-	4118888..4118944	+	57	NuclAT_17	-	-
-	4118888..4118944	+	57	NuclAT_17	-	-
-	4118888..4118944	+	57	NuclAT_17	-	-
-	4118888..4118944	+	57	NuclAT_17	-	-
HVY30_RS19870	4119206..4119313	-	108	WP_072132476.1	type I toxin-antitoxin system toxin Ldr family protein	-
HVY30_RS19875	4119688..4119795	-	108	WP_000170738.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4119844..4119907	+	64	NuclAT_19	-	-
-	4119844..4119907	+	64	NuclAT_19	-	-
-	4119844..4119907	+	64	NuclAT_19	-	-
-	4119844..4119907	+	64	NuclAT_19	-	-
-	4119844..4119907	+	64	NuclAT_22	-	-
-	4119844..4119907	+	64	NuclAT_22	-	-
-	4119844..4119907	+	64	NuclAT_22	-	-
-	4119844..4119907	+	64	NuclAT_22	-	-
-	4119844..4119907	+	64	NuclAT_25	-	-
-	4119844..4119907	+	64	NuclAT_25	-	-
-	4119844..4119907	+	64	NuclAT_25	-	-
-	4119844..4119907	+	64	NuclAT_25	-	-
-	4119844..4119907	+	64	NuclAT_28	-	-
-	4119844..4119907	+	64	NuclAT_28	-	-
-	4119844..4119907	+	64	NuclAT_28	-	-
-	4119844..4119907	+	64	NuclAT_28	-	-
-	4119844..4119909	+	66	NuclAT_13	-	-
-	4119844..4119909	+	66	NuclAT_13	-	-
-	4119844..4119909	+	66	NuclAT_13	-	-
-	4119844..4119909	+	66	NuclAT_13	-	-
-	4119844..4119909	+	66	NuclAT_16	-	-
-	4119844..4119909	+	66	NuclAT_16	-	-
-	4119844..4119909	+	66	NuclAT_16	-	-
-	4119844..4119909	+	66	NuclAT_16	-	-
HVY30_RS19880	4120171..4120278	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4120327..4120390	+	64	NuclAT_18	-	-
-	4120327..4120390	+	64	NuclAT_18	-	-
-	4120327..4120390	+	64	NuclAT_18	-	-
-	4120327..4120390	+	64	NuclAT_18	-	-
-	4120327..4120390	+	64	NuclAT_21	-	-
-	4120327..4120390	+	64	NuclAT_21	-	-
-	4120327..4120390	+	64	NuclAT_21	-	-
-	4120327..4120390	+	64	NuclAT_21	-	-
-	4120327..4120390	+	64	NuclAT_24	-	-
-	4120327..4120390	+	64	NuclAT_24	-	-
-	4120327..4120390	+	64	NuclAT_24	-	-
-	4120327..4120390	+	64	NuclAT_24	-	-
-	4120327..4120390	+	64	NuclAT_27	-	-
-	4120327..4120390	+	64	NuclAT_27	-	-
-	4120327..4120390	+	64	NuclAT_27	-	-
-	4120327..4120390	+	64	NuclAT_27	-	-
-	4120327..4120392	+	66	NuclAT_12	-	-
-	4120327..4120392	+	66	NuclAT_12	-	-
-	4120327..4120392	+	66	NuclAT_12	-	-
-	4120327..4120392	+	66	NuclAT_12	-	-
-	4120327..4120392	+	66	NuclAT_15	-	-
-	4120327..4120392	+	66	NuclAT_15	-	-
-	4120327..4120392	+	66	NuclAT_15	-	-
-	4120327..4120392	+	66	NuclAT_15	-	-
HVY30_RS19885	4120714..4121910	+	1197	WP_001016304.1	methionine gamma-lyase	-
HVY30_RS19890	4122160..4123458	+	1299	WP_181667967.1	amino acid permease	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3867.67 Da
• Isoelectric Point: 9.0157

>T165302 WP_114091462.1 NZ_CP057458:c4118830-4118723 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVITGILASLIVSWLNKRK

Nucleotide

• Length: 108 bp

>T165302 NZ_CP073792:c76668-76336 [Klebsiella pneumoniae]
ATGGTATCTCGTTTTGTGCCGGATGCTGGCGACCTTATCTGGATAAATTTTGATCCCGTGGAAGGACATGAGCAAGGAGG
GCATCGCCCCGCAGTCGTGCTGAGTCCGTTTGCATACAACAACAAAACAGGTTTGTTGCTGTGCGTACCTTGCACAACAA
AAGTAAAAGGCTATCCCTTTGAAGTTGAATTGCCAGGAGAACGCGATGGTGTAGCTCTTGCAGATCAAATAACGTGTGTA
GACTGGCGAGCCAGAAAAGTAGAAAAGAAGGGAAAGGTTGCCACCGGAGAATTGTCAGAAATCAGAGCTAAAGCAAAAGC
CTTAATCGGTTGA

Antitoxin

Nucleotide

• Length: 55 bp

>AT165302 NZ_CP057458:4118888-4118942 [Escherichia fergusonii]
CAAGAATGGCCCCCGTGATGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Antitoxin