Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-sokX/Ldr(toxin)
Location 4314051..4314270 Replicon chromosome
Accession NZ_CP057104
Organism Escherichia fergusonii strain RHB38-C01

Toxin (Protein)


Gene name ldrD Uniprot ID A0A829L523
Locus tag HVZ66_RS20900 Protein ID WP_000170738.1
Coordinates 4314051..4314158 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name sokX
Locus tag -
Coordinates 4314207..4314270 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HVZ66_RS20870 4309100..4309288 - 189 WP_001063310.1 YhjR family protein -
HVZ66_RS20875 4309575..4311134 + 1560 WP_123059578.1 cellulose biosynthesis protein BcsE -
HVZ66_RS20880 4311131..4311322 + 192 WP_000981122.1 cellulose biosynthesis protein BcsF -
HVZ66_RS20885 4311319..4312998 + 1680 WP_000192007.1 cellulose biosynthesis protein BcsG -
HVZ66_RS20890 4313085..4313192 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4313250..4313304 + 55 NuclAT_22 - -
- 4313250..4313304 + 55 NuclAT_22 - -
- 4313250..4313304 + 55 NuclAT_22 - -
- 4313250..4313304 + 55 NuclAT_22 - -
- 4313250..4313304 + 55 NuclAT_25 - -
- 4313250..4313304 + 55 NuclAT_25 - -
- 4313250..4313304 + 55 NuclAT_25 - -
- 4313250..4313304 + 55 NuclAT_25 - -
- 4313250..4313304 + 55 NuclAT_28 - -
- 4313250..4313304 + 55 NuclAT_28 - -
- 4313250..4313304 + 55 NuclAT_28 - -
- 4313250..4313304 + 55 NuclAT_28 - -
- 4313250..4313304 + 55 NuclAT_31 - -
- 4313250..4313304 + 55 NuclAT_31 - -
- 4313250..4313304 + 55 NuclAT_31 - -
- 4313250..4313304 + 55 NuclAT_31 - -
- 4313250..4313306 + 57 NuclAT_15 - -
- 4313250..4313306 + 57 NuclAT_15 - -
- 4313250..4313306 + 57 NuclAT_15 - -
- 4313250..4313306 + 57 NuclAT_15 - -
- 4313250..4313306 + 57 NuclAT_18 - -
- 4313250..4313306 + 57 NuclAT_18 - -
- 4313250..4313306 + 57 NuclAT_18 - -
- 4313250..4313306 + 57 NuclAT_18 - -
HVZ66_RS20895 4313568..4313675 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein -
HVZ66_RS20900 4314051..4314158 - 108 WP_000170738.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4314207..4314270 + 64 NuclAT_21 - Antitoxin
- 4314207..4314270 + 64 NuclAT_21 - Antitoxin
- 4314207..4314270 + 64 NuclAT_21 - Antitoxin
- 4314207..4314270 + 64 NuclAT_21 - Antitoxin
- 4314207..4314270 + 64 NuclAT_24 - Antitoxin
- 4314207..4314270 + 64 NuclAT_24 - Antitoxin
- 4314207..4314270 + 64 NuclAT_24 - Antitoxin
- 4314207..4314270 + 64 NuclAT_24 - Antitoxin
- 4314207..4314270 + 64 NuclAT_27 - Antitoxin
- 4314207..4314270 + 64 NuclAT_27 - Antitoxin
- 4314207..4314270 + 64 NuclAT_27 - Antitoxin
- 4314207..4314270 + 64 NuclAT_27 - Antitoxin
- 4314207..4314270 + 64 NuclAT_30 - Antitoxin
- 4314207..4314270 + 64 NuclAT_30 - Antitoxin
- 4314207..4314270 + 64 NuclAT_30 - Antitoxin
- 4314207..4314270 + 64 NuclAT_30 - Antitoxin
- 4314207..4314272 + 66 NuclAT_14 - -
- 4314207..4314272 + 66 NuclAT_14 - -
- 4314207..4314272 + 66 NuclAT_14 - -
- 4314207..4314272 + 66 NuclAT_14 - -
- 4314207..4314272 + 66 NuclAT_17 - -
- 4314207..4314272 + 66 NuclAT_17 - -
- 4314207..4314272 + 66 NuclAT_17 - -
- 4314207..4314272 + 66 NuclAT_17 - -
HVZ66_RS20905 4314534..4314641 - 108 WP_001295224.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4314690..4314753 + 64 NuclAT_20 - -
- 4314690..4314753 + 64 NuclAT_20 - -
- 4314690..4314753 + 64 NuclAT_20 - -
- 4314690..4314753 + 64 NuclAT_20 - -
- 4314690..4314753 + 64 NuclAT_23 - -
- 4314690..4314753 + 64 NuclAT_23 - -
- 4314690..4314753 + 64 NuclAT_23 - -
- 4314690..4314753 + 64 NuclAT_23 - -
- 4314690..4314753 + 64 NuclAT_26 - -
- 4314690..4314753 + 64 NuclAT_26 - -
- 4314690..4314753 + 64 NuclAT_26 - -
- 4314690..4314753 + 64 NuclAT_26 - -
- 4314690..4314753 + 64 NuclAT_29 - -
- 4314690..4314753 + 64 NuclAT_29 - -
- 4314690..4314753 + 64 NuclAT_29 - -
- 4314690..4314753 + 64 NuclAT_29 - -
- 4314690..4314755 + 66 NuclAT_13 - -
- 4314690..4314755 + 66 NuclAT_13 - -
- 4314690..4314755 + 66 NuclAT_13 - -
- 4314690..4314755 + 66 NuclAT_13 - -
- 4314690..4314755 + 66 NuclAT_16 - -
- 4314690..4314755 + 66 NuclAT_16 - -
- 4314690..4314755 + 66 NuclAT_16 - -
- 4314690..4314755 + 66 NuclAT_16 - -
HVZ66_RS20910 4315078..4316274 + 1197 WP_180492127.1 methionine gamma-lyase -
HVZ66_RS20915 4316523..4317821 + 1299 WP_148047743.1 amino acid permease -
HVZ66_RS20920 4317837..4319048 - 1212 WP_125400891.1 sigma 54-interacting transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3864.67 Da        Isoelectric Point: 9.0157

>T164812 WP_000170738.1 NZ_CP057104:c4314158-4314051 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASLIVNWLNKRK

Download         Length: 108 bp

>T164812 NZ_CP073310:c3512900-3512616 [Enterobacter cloacae]
ATGACTTATGAACTGGAATTTGACCCGAGGGCGTTAAAAGAGTGGAGCAAGCTGGGGGAGACTGTAAAAAAGCAGTTCAG
GAAGAAACTTGCCGGGGTGTTGGTAAACCCCCGGATCGAATCGGCCCGTCTGCATAATCTGCCTGATTGCTACAAAATAA
AACTCAGATCCCAGGGTTACCGTTTGGTCTATCAGGTTCAGGACAACGTGGTAACGGTAGTTGTCGTCGCCATTGGGAAA
AGAGAGAAATCAGCCGTATATCACGATGCTAACAAACGGCTATAG

Antitoxin


Download         Length: 64 bp

>AT164812 NZ_CP057104:4314207-4314270 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829L523

Antitoxin

Download structure file

References