Detailed information of TA system TA164594

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-sokC/Ldr(toxin)
• Location: 4412264..4412483
• Replicon: chromosome
• Accession: NZ_CP056961
• Organism: Escherichia fergusonii strain RHB41-C20

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: HV012_RS21405
• Protein ID: WP_001295224.1
• Coordinates: 4412264..4412371 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	sokC
Locus tag	-
Coordinates	4412420..4412483 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HV012_RS21375	4407324..4407512	-	189	WP_001063310.1	YhjR family protein	-
HV012_RS21380	4407799..4409358	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HV012_RS21385	4409355..4409546	+	192	WP_000981122.1	cellulose biosynthesis protein BcsF	-
HV012_RS21390	4409543..4411222	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HV012_RS21395	4411309..4411416	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4411474..4411528	+	55	NuclAT_16	-	-
-	4411474..4411528	+	55	NuclAT_16	-	-
-	4411474..4411528	+	55	NuclAT_16	-	-
-	4411474..4411528	+	55	NuclAT_16	-	-
-	4411474..4411528	+	55	NuclAT_19	-	-
-	4411474..4411528	+	55	NuclAT_19	-	-
-	4411474..4411528	+	55	NuclAT_19	-	-
-	4411474..4411528	+	55	NuclAT_19	-	-
-	4411474..4411528	+	55	NuclAT_22	-	-
-	4411474..4411528	+	55	NuclAT_22	-	-
-	4411474..4411528	+	55	NuclAT_22	-	-
-	4411474..4411528	+	55	NuclAT_22	-	-
-	4411474..4411528	+	55	NuclAT_25	-	-
-	4411474..4411528	+	55	NuclAT_25	-	-
-	4411474..4411528	+	55	NuclAT_25	-	-
-	4411474..4411528	+	55	NuclAT_25	-	-
-	4411474..4411530	+	57	NuclAT_10	-	-
-	4411474..4411530	+	57	NuclAT_10	-	-
-	4411474..4411530	+	57	NuclAT_10	-	-
-	4411474..4411530	+	57	NuclAT_10	-	-
-	4411474..4411530	+	57	NuclAT_13	-	-
-	4411474..4411530	+	57	NuclAT_13	-	-
-	4411474..4411530	+	57	NuclAT_13	-	-
-	4411474..4411530	+	57	NuclAT_13	-	-
HV012_RS21400	4411792..4411899	-	108	WP_181588055.1	type I toxin-antitoxin system toxin Ldr family protein	-
-	4411948..4412011	+	64	NuclAT_15	-	-
-	4411948..4412011	+	64	NuclAT_15	-	-
-	4411948..4412011	+	64	NuclAT_15	-	-
-	4411948..4412011	+	64	NuclAT_15	-	-
-	4411948..4412011	+	64	NuclAT_18	-	-
-	4411948..4412011	+	64	NuclAT_18	-	-
-	4411948..4412011	+	64	NuclAT_18	-	-
-	4411948..4412011	+	64	NuclAT_18	-	-
-	4411948..4412011	+	64	NuclAT_21	-	-
-	4411948..4412011	+	64	NuclAT_21	-	-
-	4411948..4412011	+	64	NuclAT_21	-	-
-	4411948..4412011	+	64	NuclAT_21	-	-
-	4411948..4412011	+	64	NuclAT_24	-	-
-	4411948..4412011	+	64	NuclAT_24	-	-
-	4411948..4412011	+	64	NuclAT_24	-	-
-	4411948..4412011	+	64	NuclAT_24	-	-
-	4411948..4412013	+	66	NuclAT_12	-	-
-	4411948..4412013	+	66	NuclAT_12	-	-
-	4411948..4412013	+	66	NuclAT_12	-	-
-	4411948..4412013	+	66	NuclAT_12	-	-
-	4411948..4412013	+	66	NuclAT_9	-	-
-	4411948..4412013	+	66	NuclAT_9	-	-
-	4411948..4412013	+	66	NuclAT_9	-	-
-	4411948..4412013	+	66	NuclAT_9	-	-
HV012_RS21405	4412264..4412371	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4412420..4412483	+	64	NuclAT_14	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_14	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_14	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_14	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_17	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_17	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_17	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_17	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_20	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_20	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_20	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_20	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_23	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_23	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_23	-	Antitoxin
-	4412420..4412483	+	64	NuclAT_23	-	Antitoxin
-	4412420..4412485	+	66	NuclAT_11	-	-
-	4412420..4412485	+	66	NuclAT_11	-	-
-	4412420..4412485	+	66	NuclAT_11	-	-
-	4412420..4412485	+	66	NuclAT_11	-	-
-	4412420..4412485	+	66	NuclAT_8	-	-
-	4412420..4412485	+	66	NuclAT_8	-	-
-	4412420..4412485	+	66	NuclAT_8	-	-
-	4412420..4412485	+	66	NuclAT_8	-	-
HV012_RS21410	4412808..4414004	+	1197	WP_181588056.1	methionine gamma-lyase	-
HV012_RS21415	4414253..4415551	+	1299	WP_181588057.1	amino acid permease	-
HV012_RS21420	4415567..4416778	-	1212	WP_181588058.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T164594 WP_001295224.1 NZ_CP056961:c4412371-4412264 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T164594 NZ_CP072988:c3354900-3354748 [Xanthomonas translucens pv. translucens]
ATGAAGCGACTGTTCACCTTGACGATGCTGACCCTGTTTTGTGCAGGCATGCTGACCGGCTGCAACACCATGGCCGGCGC
CGGTAAGGACATGCAGAAGGCCGGCGATAAGGTGGAAACCAAGGCCGACGACTGTAAAGACGGCAAGTGCTGA

Antitoxin

Nucleotide

• Length: 64 bp

>AT164594 NZ_CP056961:4412420-4412483 [Escherichia fergusonii]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGAATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin