Detailed information of TA system TA164514

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): ldrD-ohsC/Ldr(toxin)
• Location: 4164050..4164269
• Replicon: chromosome
• Accession: NZ_CP056916
• Organism: Escherichia fergusonii strain RHB42-C24

Toxin (Protein)

• Gene name: ldrD
• Uniprot ID: S1NWX0
• Locus tag: HV025_RS19960
• Protein ID: WP_001295224.1
• Coordinates: 4164050..4164157 (-)
• Length: 36 a.a.

Antitoxin (RNA)

Gene name	ohsC
Locus tag	-
Coordinates	4164206..4164269 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
HV025_RS19930	4159098..4159286	-	189	WP_001063310.1	YhjR family protein	-
HV025_RS19935	4159573..4161132	+	1560	WP_001070267.1	cellulose biosynthesis protein BcsE	-
HV025_RS19940	4161129..4161320	+	192	WP_046077700.1	cellulose biosynthesis protein BcsF	-
HV025_RS19945	4161317..4162996	+	1680	WP_000192007.1	cellulose biosynthesis protein BcsG	-
HV025_RS19950	4163083..4163190	-	108	WP_114091462.1	type I toxin-antitoxin system toxin Ldr family protein	-
HV025_RS19955	4163566..4163673	-	108	WP_002431793.1	type I toxin-antitoxin system toxin Ldr family protein	-
HV025_RS19960	4164050..4164157	-	108	WP_001295224.1	type I toxin-antitoxin system toxin Ldr family protein	Toxin
-	4164206..4164269	+	64	NuclAT_15	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_15	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_15	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_15	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_16	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_16	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_16	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_16	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_17	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_17	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_17	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_17	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_18	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_18	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_18	-	Antitoxin
-	4164206..4164269	+	64	NuclAT_18	-	Antitoxin
-	4164206..4164271	+	66	NuclAT_13	-	-
-	4164206..4164271	+	66	NuclAT_13	-	-
-	4164206..4164271	+	66	NuclAT_13	-	-
-	4164206..4164271	+	66	NuclAT_13	-	-
-	4164206..4164271	+	66	NuclAT_14	-	-
-	4164206..4164271	+	66	NuclAT_14	-	-
-	4164206..4164271	+	66	NuclAT_14	-	-
-	4164206..4164271	+	66	NuclAT_14	-	-
HV025_RS19965	4164594..4165790	+	1197	WP_181465070.1	methionine gamma-lyase	-
HV025_RS19970	4166040..4167338	+	1299	WP_001152711.1	amino acid permease	-
HV025_RS19975	4167354..4168565	-	1212	WP_125282763.1	sigma 54-interacting transcriptional regulator	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Type I toxin-antitoxin system, toxin Ldr (1-35)

Sequences

Toxin

Protein

• Length: 36 a.a.
• Molecular weight: 3882.70 Da
• Isoelectric Point: 9.0157

>T164514 WP_001295224.1 NZ_CP056916:c4164157-4164050 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK

Nucleotide

• Length: 108 bp

>T164514 NZ_CP072970:c4586192-4586007 [Enterobacter sp. BWH 37]
GTGAAAAGTGCGGATATCATTACTGTTCTGGTTAGCCATGGCTGGAAATGTGTAAGAACGAAGGGAAGCCATCATCAGTT
TCGCCATCCAGTGCAAAAAGGGTTGGTTACCGTCCCACATCCTAAAAAGGACATTAAACCAGGCACTCTCGCACAAATCT
GGCGACAGGCGGGAATTAAACACTGA

Antitoxin

Nucleotide

• Length: 64 bp

>AT164514 NZ_CP056916:4164206-4164269 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT

Structures

Toxin

• AlphaFold DB: A0A4P7TSJ7

Antitoxin