Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 4164050..4164269 | Replicon | chromosome |
| Accession | NZ_CP056916 | ||
| Organism | Escherichia fergusonii strain RHB42-C24 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | HV025_RS19960 | Protein ID | WP_001295224.1 |
| Coordinates | 4164050..4164157 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 4164206..4164269 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HV025_RS19930 | 4159098..4159286 | - | 189 | WP_001063310.1 | YhjR family protein | - |
| HV025_RS19935 | 4159573..4161132 | + | 1560 | WP_001070267.1 | cellulose biosynthesis protein BcsE | - |
| HV025_RS19940 | 4161129..4161320 | + | 192 | WP_046077700.1 | cellulose biosynthesis protein BcsF | - |
| HV025_RS19945 | 4161317..4162996 | + | 1680 | WP_000192007.1 | cellulose biosynthesis protein BcsG | - |
| HV025_RS19950 | 4163083..4163190 | - | 108 | WP_114091462.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| HV025_RS19955 | 4163566..4163673 | - | 108 | WP_002431793.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| HV025_RS19960 | 4164050..4164157 | - | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 4164206..4164269 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_15 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_16 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_16 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_16 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_16 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_17 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4164206..4164269 | + | 64 | NuclAT_18 | - | Antitoxin |
| - | 4164206..4164271 | + | 66 | NuclAT_13 | - | - |
| - | 4164206..4164271 | + | 66 | NuclAT_13 | - | - |
| - | 4164206..4164271 | + | 66 | NuclAT_13 | - | - |
| - | 4164206..4164271 | + | 66 | NuclAT_13 | - | - |
| - | 4164206..4164271 | + | 66 | NuclAT_14 | - | - |
| - | 4164206..4164271 | + | 66 | NuclAT_14 | - | - |
| - | 4164206..4164271 | + | 66 | NuclAT_14 | - | - |
| - | 4164206..4164271 | + | 66 | NuclAT_14 | - | - |
| HV025_RS19965 | 4164594..4165790 | + | 1197 | WP_181465070.1 | methionine gamma-lyase | - |
| HV025_RS19970 | 4166040..4167338 | + | 1299 | WP_001152711.1 | amino acid permease | - |
| HV025_RS19975 | 4167354..4168565 | - | 1212 | WP_125282763.1 | sigma 54-interacting transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T164514 WP_001295224.1 NZ_CP056916:c4164157-4164050 [Escherichia fergusonii]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T164514 NZ_CP072970:c4586192-4586007 [Enterobacter sp. BWH 37]
GTGAAAAGTGCGGATATCATTACTGTTCTGGTTAGCCATGGCTGGAAATGTGTAAGAACGAAGGGAAGCCATCATCAGTT
TCGCCATCCAGTGCAAAAAGGGTTGGTTACCGTCCCACATCCTAAAAAGGACATTAAACCAGGCACTCTCGCACAAATCT
GGCGACAGGCGGGAATTAAACACTGA
GTGAAAAGTGCGGATATCATTACTGTTCTGGTTAGCCATGGCTGGAAATGTGTAAGAACGAAGGGAAGCCATCATCAGTT
TCGCCATCCAGTGCAAAAAGGGTTGGTTACCGTCCCACATCCTAAAAAGGACATTAAACCAGGCACTCTCGCACAAATCT
GGCGACAGGCGGGAATTAAACACTGA
Antitoxin
Download Length: 64 bp
>AT164514 NZ_CP056916:4164206-4164269 [Escherichia fergusonii]
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
GTCTAGATGCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|