Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 4674594..4674814 Replicon chromosome
Accession NZ_CP055292
Organism Shigella sonnei strain SE6-1

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag HUX90_RS22315 Protein ID WP_000170965.1
Coordinates 4674707..4674814 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 4674594..4674660 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HUX90_RS22290 4669873..4671267 - 1395 WP_000086201.1 inverse autotransporter invasin YchO -
HUX90_RS22295 4671452..4671805 + 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HUX90_RS22300 4671849..4672544 - 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
HUX90_RS22305 4672702..4672932 - 231 WP_001146442.1 putative cation transport regulator ChaB -
HUX90_RS22310 4673202..4674302 + 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
- 4674594..4674660 - 67 - - Antitoxin
HUX90_RS22315 4674707..4674814 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 4675127..4675190 - 64 NuclAT_34 - -
- 4675127..4675190 - 64 NuclAT_34 - -
- 4675127..4675190 - 64 NuclAT_34 - -
- 4675127..4675190 - 64 NuclAT_34 - -
- 4675127..4675190 - 64 NuclAT_36 - -
- 4675127..4675190 - 64 NuclAT_36 - -
- 4675127..4675190 - 64 NuclAT_36 - -
- 4675127..4675190 - 64 NuclAT_36 - -
- 4675127..4675190 - 64 NuclAT_38 - -
- 4675127..4675190 - 64 NuclAT_38 - -
- 4675127..4675190 - 64 NuclAT_38 - -
- 4675127..4675190 - 64 NuclAT_38 - -
- 4675127..4675190 - 64 NuclAT_40 - -
- 4675127..4675190 - 64 NuclAT_40 - -
- 4675127..4675190 - 64 NuclAT_40 - -
- 4675127..4675190 - 64 NuclAT_40 - -
- 4675127..4675190 - 64 NuclAT_42 - -
- 4675127..4675190 - 64 NuclAT_42 - -
- 4675127..4675190 - 64 NuclAT_42 - -
- 4675127..4675190 - 64 NuclAT_42 - -
- 4675127..4675190 - 64 NuclAT_44 - -
- 4675127..4675190 - 64 NuclAT_44 - -
- 4675127..4675190 - 64 NuclAT_44 - -
- 4675127..4675190 - 64 NuclAT_44 - -
- 4675128..4675190 - 63 NuclAT_46 - -
- 4675128..4675190 - 63 NuclAT_46 - -
- 4675128..4675190 - 63 NuclAT_46 - -
- 4675128..4675190 - 63 NuclAT_46 - -
- 4675128..4675190 - 63 NuclAT_49 - -
- 4675128..4675190 - 63 NuclAT_49 - -
- 4675128..4675190 - 63 NuclAT_49 - -
- 4675128..4675190 - 63 NuclAT_49 - -
- 4675129..4675190 - 62 NuclAT_16 - -
- 4675129..4675190 - 62 NuclAT_16 - -
- 4675129..4675190 - 62 NuclAT_16 - -
- 4675129..4675190 - 62 NuclAT_16 - -
- 4675129..4675190 - 62 NuclAT_19 - -
- 4675129..4675190 - 62 NuclAT_19 - -
- 4675129..4675190 - 62 NuclAT_19 - -
- 4675129..4675190 - 62 NuclAT_19 - -
- 4675129..4675190 - 62 NuclAT_22 - -
- 4675129..4675190 - 62 NuclAT_22 - -
- 4675129..4675190 - 62 NuclAT_22 - -
- 4675129..4675190 - 62 NuclAT_22 - -
- 4675129..4675190 - 62 NuclAT_25 - -
- 4675129..4675190 - 62 NuclAT_25 - -
- 4675129..4675190 - 62 NuclAT_25 - -
- 4675129..4675190 - 62 NuclAT_25 - -
- 4675129..4675190 - 62 NuclAT_28 - -
- 4675129..4675190 - 62 NuclAT_28 - -
- 4675129..4675190 - 62 NuclAT_28 - -
- 4675129..4675190 - 62 NuclAT_28 - -
- 4675129..4675190 - 62 NuclAT_31 - -
- 4675129..4675190 - 62 NuclAT_31 - -
- 4675129..4675190 - 62 NuclAT_31 - -
- 4675129..4675190 - 62 NuclAT_31 - -
HUX90_RS22320 4675243..4675350 + 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 4675664..4675730 - 67 NuclAT_45 - -
- 4675664..4675730 - 67 NuclAT_45 - -
- 4675664..4675730 - 67 NuclAT_45 - -
- 4675664..4675730 - 67 NuclAT_45 - -
- 4675664..4675730 - 67 NuclAT_48 - -
- 4675664..4675730 - 67 NuclAT_48 - -
- 4675664..4675730 - 67 NuclAT_48 - -
- 4675664..4675730 - 67 NuclAT_48 - -
- 4675665..4675728 - 64 NuclAT_17 - -
- 4675665..4675728 - 64 NuclAT_17 - -
- 4675665..4675728 - 64 NuclAT_17 - -
- 4675665..4675728 - 64 NuclAT_17 - -
- 4675665..4675728 - 64 NuclAT_20 - -
- 4675665..4675728 - 64 NuclAT_20 - -
- 4675665..4675728 - 64 NuclAT_20 - -
- 4675665..4675728 - 64 NuclAT_20 - -
- 4675665..4675728 - 64 NuclAT_23 - -
- 4675665..4675728 - 64 NuclAT_23 - -
- 4675665..4675728 - 64 NuclAT_23 - -
- 4675665..4675728 - 64 NuclAT_23 - -
- 4675665..4675728 - 64 NuclAT_26 - -
- 4675665..4675728 - 64 NuclAT_26 - -
- 4675665..4675728 - 64 NuclAT_26 - -
- 4675665..4675728 - 64 NuclAT_26 - -
- 4675665..4675728 - 64 NuclAT_29 - -
- 4675665..4675728 - 64 NuclAT_29 - -
- 4675665..4675728 - 64 NuclAT_29 - -
- 4675665..4675728 - 64 NuclAT_29 - -
- 4675665..4675728 - 64 NuclAT_32 - -
- 4675665..4675728 - 64 NuclAT_32 - -
- 4675665..4675728 - 64 NuclAT_32 - -
- 4675665..4675728 - 64 NuclAT_32 - -
HUX90_RS22325 4675778..4675885 + 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
HUX90_RS22330 4676034..4676888 - 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HUX90_RS22335 4676924..4677733 - 810 WP_001257044.1 invasion regulator SirB1 -
HUX90_RS22340 4677737..4678129 - 393 WP_000200378.1 invasion regulator SirB2 -
HUX90_RS22345 4678126..4678959 - 834 WP_176527885.1 peptide chain release factor N(5)-glutamine methyltransferase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T162261 WP_000170965.1 NZ_CP055292:4674707-4674814 [Shigella sonnei]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T162261 NZ_CP071706:1102864-1103157 [Pseudomonas donghuensis]
TTGAAATACAGTGTTTTGCAAACGCCCAGATTCACCTCTTGGTTGATTTCCGTACGCGACATGCGTGCAAGGGTGGCAAT
CGCACGGCGAATAGAGCGTGTAACGGCGGGAAATCTGGGAGATGTGAAGTCCGTCGGTGGTCAGGTCTGCGAGATGCGCA
TCGATGTGGGGGCGGGTTATCGGGTGTATTTCACGGCTCGGGACGGTGTAGTCATTGTTTTGTTGGCAGGTGGTGATAAG
TCATCGCAATCTGTTGATATCCAACTGGCCAGGAAGCTGGCCAAGGAAATTTGA

Antitoxin


Download         Length: 67 bp

>AT162261 NZ_CP055292:c4674660-4674594 [Shigella sonnei]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References