Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1893490..1893711 Replicon chromosome
Accession NZ_CP054227
Organism Escherichia coli strain EcPF15

Toxin (Protein)


Gene name ldrD Uniprot ID A0A229AEQ8
Locus tag HR073_RS08830 Protein ID WP_000176713.1
Coordinates 1893490..1893597 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1893645..1893711 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HR073_RS08805 1889335..1890417 + 1083 WP_000804726.1 peptide chain release factor 1 -
HR073_RS08810 1890417..1891250 + 834 WP_000456458.1 peptide chain release factor N(5)-glutamine methyltransferase -
HR073_RS08815 1891247..1891639 + 393 WP_000151883.1 invasion regulator SirB2 -
HR073_RS08820 1891643..1892452 + 810 WP_001257044.1 invasion regulator SirB1 -
HR073_RS08825 1892488..1893342 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HR073_RS08830 1893490..1893597 - 108 WP_000176713.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1893645..1893711 + 67 NuclAT_14 - Antitoxin
- 1893645..1893711 + 67 NuclAT_14 - Antitoxin
- 1893645..1893711 + 67 NuclAT_14 - Antitoxin
- 1893645..1893711 + 67 NuclAT_14 - Antitoxin
- 1893645..1893711 + 67 NuclAT_16 - Antitoxin
- 1893645..1893711 + 67 NuclAT_16 - Antitoxin
- 1893645..1893711 + 67 NuclAT_16 - Antitoxin
- 1893645..1893711 + 67 NuclAT_16 - Antitoxin
- 1893645..1893711 + 67 NuclAT_18 - Antitoxin
- 1893645..1893711 + 67 NuclAT_18 - Antitoxin
- 1893645..1893711 + 67 NuclAT_18 - Antitoxin
- 1893645..1893711 + 67 NuclAT_18 - Antitoxin
- 1893645..1893711 + 67 NuclAT_20 - Antitoxin
- 1893645..1893711 + 67 NuclAT_20 - Antitoxin
- 1893645..1893711 + 67 NuclAT_20 - Antitoxin
- 1893645..1893711 + 67 NuclAT_20 - Antitoxin
- 1893645..1893711 + 67 NuclAT_22 - Antitoxin
- 1893645..1893711 + 67 NuclAT_22 - Antitoxin
- 1893645..1893711 + 67 NuclAT_22 - Antitoxin
- 1893645..1893711 + 67 NuclAT_22 - Antitoxin
- 1893645..1893711 + 67 NuclAT_24 - Antitoxin
- 1893645..1893711 + 67 NuclAT_24 - Antitoxin
- 1893645..1893711 + 67 NuclAT_24 - Antitoxin
- 1893645..1893711 + 67 NuclAT_24 - Antitoxin
- 1893647..1893710 + 64 NuclAT_27 - -
- 1893647..1893710 + 64 NuclAT_27 - -
- 1893647..1893710 + 64 NuclAT_27 - -
- 1893647..1893710 + 64 NuclAT_27 - -
- 1893647..1893710 + 64 NuclAT_29 - -
- 1893647..1893710 + 64 NuclAT_29 - -
- 1893647..1893710 + 64 NuclAT_29 - -
- 1893647..1893710 + 64 NuclAT_29 - -
- 1893647..1893710 + 64 NuclAT_31 - -
- 1893647..1893710 + 64 NuclAT_31 - -
- 1893647..1893710 + 64 NuclAT_31 - -
- 1893647..1893710 + 64 NuclAT_31 - -
- 1893647..1893710 + 64 NuclAT_33 - -
- 1893647..1893710 + 64 NuclAT_33 - -
- 1893647..1893710 + 64 NuclAT_33 - -
- 1893647..1893710 + 64 NuclAT_33 - -
- 1893647..1893710 + 64 NuclAT_35 - -
- 1893647..1893710 + 64 NuclAT_35 - -
- 1893647..1893710 + 64 NuclAT_35 - -
- 1893647..1893710 + 64 NuclAT_35 - -
- 1893647..1893710 + 64 NuclAT_37 - -
- 1893647..1893710 + 64 NuclAT_37 - -
- 1893647..1893710 + 64 NuclAT_37 - -
- 1893647..1893710 + 64 NuclAT_37 - -
- 1893647..1893712 + 66 NuclAT_39 - -
- 1893647..1893712 + 66 NuclAT_39 - -
- 1893647..1893712 + 66 NuclAT_39 - -
- 1893647..1893712 + 66 NuclAT_39 - -
- 1893647..1893712 + 66 NuclAT_41 - -
- 1893647..1893712 + 66 NuclAT_41 - -
- 1893647..1893712 + 66 NuclAT_41 - -
- 1893647..1893712 + 66 NuclAT_41 - -
- 1893647..1893712 + 66 NuclAT_43 - -
- 1893647..1893712 + 66 NuclAT_43 - -
- 1893647..1893712 + 66 NuclAT_43 - -
- 1893647..1893712 + 66 NuclAT_43 - -
HR073_RS08835 1894025..1894132 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1894185..1894246 + 62 NuclAT_26 - -
- 1894185..1894246 + 62 NuclAT_26 - -
- 1894185..1894246 + 62 NuclAT_26 - -
- 1894185..1894246 + 62 NuclAT_26 - -
- 1894185..1894246 + 62 NuclAT_28 - -
- 1894185..1894246 + 62 NuclAT_28 - -
- 1894185..1894246 + 62 NuclAT_28 - -
- 1894185..1894246 + 62 NuclAT_28 - -
- 1894185..1894246 + 62 NuclAT_30 - -
- 1894185..1894246 + 62 NuclAT_30 - -
- 1894185..1894246 + 62 NuclAT_30 - -
- 1894185..1894246 + 62 NuclAT_30 - -
- 1894185..1894246 + 62 NuclAT_32 - -
- 1894185..1894246 + 62 NuclAT_32 - -
- 1894185..1894246 + 62 NuclAT_32 - -
- 1894185..1894246 + 62 NuclAT_32 - -
- 1894185..1894246 + 62 NuclAT_34 - -
- 1894185..1894246 + 62 NuclAT_34 - -
- 1894185..1894246 + 62 NuclAT_34 - -
- 1894185..1894246 + 62 NuclAT_34 - -
- 1894185..1894246 + 62 NuclAT_36 - -
- 1894185..1894246 + 62 NuclAT_36 - -
- 1894185..1894246 + 62 NuclAT_36 - -
- 1894185..1894246 + 62 NuclAT_36 - -
- 1894185..1894247 + 63 NuclAT_15 - -
- 1894185..1894247 + 63 NuclAT_15 - -
- 1894185..1894247 + 63 NuclAT_15 - -
- 1894185..1894247 + 63 NuclAT_15 - -
- 1894185..1894247 + 63 NuclAT_17 - -
- 1894185..1894247 + 63 NuclAT_17 - -
- 1894185..1894247 + 63 NuclAT_17 - -
- 1894185..1894247 + 63 NuclAT_17 - -
- 1894185..1894247 + 63 NuclAT_19 - -
- 1894185..1894247 + 63 NuclAT_19 - -
- 1894185..1894247 + 63 NuclAT_19 - -
- 1894185..1894247 + 63 NuclAT_19 - -
- 1894185..1894247 + 63 NuclAT_21 - -
- 1894185..1894247 + 63 NuclAT_21 - -
- 1894185..1894247 + 63 NuclAT_21 - -
- 1894185..1894247 + 63 NuclAT_21 - -
- 1894185..1894247 + 63 NuclAT_23 - -
- 1894185..1894247 + 63 NuclAT_23 - -
- 1894185..1894247 + 63 NuclAT_23 - -
- 1894185..1894247 + 63 NuclAT_23 - -
- 1894185..1894247 + 63 NuclAT_25 - -
- 1894185..1894247 + 63 NuclAT_25 - -
- 1894185..1894247 + 63 NuclAT_25 - -
- 1894185..1894247 + 63 NuclAT_25 - -
- 1894185..1894248 + 64 NuclAT_38 - -
- 1894185..1894248 + 64 NuclAT_38 - -
- 1894185..1894248 + 64 NuclAT_38 - -
- 1894185..1894248 + 64 NuclAT_38 - -
- 1894185..1894248 + 64 NuclAT_40 - -
- 1894185..1894248 + 64 NuclAT_40 - -
- 1894185..1894248 + 64 NuclAT_40 - -
- 1894185..1894248 + 64 NuclAT_40 - -
- 1894185..1894248 + 64 NuclAT_42 - -
- 1894185..1894248 + 64 NuclAT_42 - -
- 1894185..1894248 + 64 NuclAT_42 - -
- 1894185..1894248 + 64 NuclAT_42 - -
HR073_RS08840 1894538..1895638 - 1101 WP_001309461.1 sodium-potassium/proton antiporter ChaA -
HR073_RS08845 1895908..1896138 + 231 WP_001146450.1 putative cation transport regulator ChaB -
HR073_RS08850 1896296..1896991 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
HR073_RS08855 1897035..1897388 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4031.79 Da        Isoelectric Point: 11.4779

>T159066 WP_000176713.1 NZ_CP054227:c1893597-1893490 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T159066 NZ_CP069946:c3130953-3130606 [Klebsiella pneumoniae]
ATGTGGGATGTGGAAACGACGGATACGTTTGATGCCTGGTTCGAATTACAAAGTAGAGCTTTAAAAGAGGATATGTTGGC
CACGATGCTCATCTTGTCTGAGTTTGCTCCGCAGCTTGGGCGCCCGTATGTTGATACGGTGAAAGATTCAACGTTTCAGA
ATATGAAAGAACTGCGGGTTCAGCATCATGGGCTCCCCATCCGCGCCTTTTTTGCTTTTGATCCTCTGCGGAAAGCTATC
GTTTTATGTGCGGGCAATAAGGATGGCATAAATGAGAAACGTTTTTACAAAGAGATGATTACTCTGGCTGACAGAGAATT
CAGCCAACACCTGACTAAGGAGCGATAA

Antitoxin


Download         Length: 67 bp

>AT159066 NZ_CP054227:1893645-1893711 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A229AEQ8

Antitoxin

Download structure file

References