Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1893490..1893711 | Replicon | chromosome |
| Accession | NZ_CP054227 | ||
| Organism | Escherichia coli strain EcPF15 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | A0A229AEQ8 |
| Locus tag | HR073_RS08830 | Protein ID | WP_000176713.1 |
| Coordinates | 1893490..1893597 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1893645..1893711 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| HR073_RS08805 | 1889335..1890417 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| HR073_RS08810 | 1890417..1891250 | + | 834 | WP_000456458.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| HR073_RS08815 | 1891247..1891639 | + | 393 | WP_000151883.1 | invasion regulator SirB2 | - |
| HR073_RS08820 | 1891643..1892452 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| HR073_RS08825 | 1892488..1893342 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| HR073_RS08830 | 1893490..1893597 | - | 108 | WP_000176713.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1893645..1893711 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_14 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_16 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_18 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_20 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_22 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1893645..1893711 | + | 67 | NuclAT_24 | - | Antitoxin |
| - | 1893647..1893710 | + | 64 | NuclAT_27 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_27 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_27 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_27 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_29 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_29 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_29 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_29 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_31 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_31 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_31 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_31 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_33 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_33 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_33 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_33 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_35 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_35 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_35 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_35 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_37 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_37 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_37 | - | - |
| - | 1893647..1893710 | + | 64 | NuclAT_37 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_39 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_39 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_39 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_39 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_41 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_41 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_41 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_41 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_43 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_43 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_43 | - | - |
| - | 1893647..1893712 | + | 66 | NuclAT_43 | - | - |
| HR073_RS08835 | 1894025..1894132 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 1894185..1894246 | + | 62 | NuclAT_26 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_26 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_26 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_26 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_28 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_28 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_28 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_28 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_30 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_30 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_30 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_30 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_32 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_32 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_32 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_32 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_34 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_34 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_34 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_34 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_36 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_36 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_36 | - | - |
| - | 1894185..1894246 | + | 62 | NuclAT_36 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_15 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_15 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_15 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_15 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_17 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_17 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_17 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_17 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_19 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_19 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_19 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_19 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_21 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_21 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_21 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_21 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_23 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_23 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_23 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_23 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_25 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_25 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_25 | - | - |
| - | 1894185..1894247 | + | 63 | NuclAT_25 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_38 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_38 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_38 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_38 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_40 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_40 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_40 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_40 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_42 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_42 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_42 | - | - |
| - | 1894185..1894248 | + | 64 | NuclAT_42 | - | - |
| HR073_RS08840 | 1894538..1895638 | - | 1101 | WP_001309461.1 | sodium-potassium/proton antiporter ChaA | - |
| HR073_RS08845 | 1895908..1896138 | + | 231 | WP_001146450.1 | putative cation transport regulator ChaB | - |
| HR073_RS08850 | 1896296..1896991 | + | 696 | WP_001336325.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| HR073_RS08855 | 1897035..1897388 | - | 354 | WP_001169659.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 4031.79 Da Isoelectric Point: 11.4779
>T159066 WP_000176713.1 NZ_CP054227:c1893597-1893490 [Escherichia coli]
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
MTLTQFAMTFWHDLAAPILAGIITAAIVSWWRNRK
Download Length: 108 bp
>T159066 NZ_CP069946:c3130953-3130606 [Klebsiella pneumoniae]
ATGTGGGATGTGGAAACGACGGATACGTTTGATGCCTGGTTCGAATTACAAAGTAGAGCTTTAAAAGAGGATATGTTGGC
CACGATGCTCATCTTGTCTGAGTTTGCTCCGCAGCTTGGGCGCCCGTATGTTGATACGGTGAAAGATTCAACGTTTCAGA
ATATGAAAGAACTGCGGGTTCAGCATCATGGGCTCCCCATCCGCGCCTTTTTTGCTTTTGATCCTCTGCGGAAAGCTATC
GTTTTATGTGCGGGCAATAAGGATGGCATAAATGAGAAACGTTTTTACAAAGAGATGATTACTCTGGCTGACAGAGAATT
CAGCCAACACCTGACTAAGGAGCGATAA
ATGTGGGATGTGGAAACGACGGATACGTTTGATGCCTGGTTCGAATTACAAAGTAGAGCTTTAAAAGAGGATATGTTGGC
CACGATGCTCATCTTGTCTGAGTTTGCTCCGCAGCTTGGGCGCCCGTATGTTGATACGGTGAAAGATTCAACGTTTCAGA
ATATGAAAGAACTGCGGGTTCAGCATCATGGGCTCCCCATCCGCGCCTTTTTTGCTTTTGATCCTCTGCGGAAAGCTATC
GTTTTATGTGCGGGCAATAAGGATGGCATAAATGAGAAACGTTTTTACAAAGAGATGATTACTCTGGCTGACAGAGAATT
CAGCCAACACCTGACTAAGGAGCGATAA
Antitoxin
Download Length: 67 bp
>AT159066 NZ_CP054227:1893645-1893711 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTATACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|