Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1677836..1678057 Replicon chromosome
Accession NZ_CP051659
Organism Escherichia coli strain 1162C

Toxin (Protein)


Gene name ldrD Uniprot ID A0A1U9U3P9
Locus tag HH202_RS08470 Protein ID WP_001531632.1
Coordinates 1677836..1677943 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1677991..1678057 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HH202_RS08445 (1673680) 1673680..1674762 + 1083 WP_000804726.1 peptide chain release factor 1 -
HH202_RS08450 (1674762) 1674762..1675595 + 834 WP_000456450.1 peptide chain release factor N(5)-glutamine methyltransferase -
HH202_RS08455 (1675592) 1675592..1675984 + 393 WP_000200375.1 invasion regulator SirB2 -
HH202_RS08460 (1675988) 1675988..1676797 + 810 WP_001257044.1 invasion regulator SirB1 -
HH202_RS08465 (1676833) 1676833..1677687 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HH202_RS08470 (1677836) 1677836..1677943 - 108 WP_001531632.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- (1677993) 1677993..1678056 + 64 NuclAT_12 - -
- (1677993) 1677993..1678056 + 64 NuclAT_12 - -
- (1677993) 1677993..1678056 + 64 NuclAT_12 - -
- (1677993) 1677993..1678056 + 64 NuclAT_12 - -
- (1677993) 1677993..1678056 + 64 NuclAT_13 - -
- (1677993) 1677993..1678056 + 64 NuclAT_13 - -
- (1677993) 1677993..1678056 + 64 NuclAT_13 - -
- (1677993) 1677993..1678056 + 64 NuclAT_13 - -
- (1677993) 1677993..1678056 + 64 NuclAT_14 - -
- (1677993) 1677993..1678056 + 64 NuclAT_14 - -
- (1677993) 1677993..1678056 + 64 NuclAT_14 - -
- (1677993) 1677993..1678056 + 64 NuclAT_14 - -
- (1677993) 1677993..1678056 + 64 NuclAT_15 - -
- (1677993) 1677993..1678056 + 64 NuclAT_15 - -
- (1677993) 1677993..1678056 + 64 NuclAT_15 - -
- (1677993) 1677993..1678056 + 64 NuclAT_15 - -
- (1677993) 1677993..1678056 + 64 NuclAT_16 - -
- (1677993) 1677993..1678056 + 64 NuclAT_16 - -
- (1677993) 1677993..1678056 + 64 NuclAT_16 - -
- (1677993) 1677993..1678056 + 64 NuclAT_16 - -
- (1677993) 1677993..1678056 + 64 NuclAT_17 - -
- (1677993) 1677993..1678056 + 64 NuclAT_17 - -
- (1677993) 1677993..1678056 + 64 NuclAT_17 - -
- (1677993) 1677993..1678056 + 64 NuclAT_17 - -
- (1677991) 1677991..1678057 + 67 NuclAT_10 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_10 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_10 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_10 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_5 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_5 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_5 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_5 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_6 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_6 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_6 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_6 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_7 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_7 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_7 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_7 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_8 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_8 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_8 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_8 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_9 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_9 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_9 - Antitoxin
- (1677991) 1677991..1678057 + 67 NuclAT_9 - Antitoxin
- (1677993) 1677993..1678058 + 66 NuclAT_18 - -
- (1677993) 1677993..1678058 + 66 NuclAT_18 - -
- (1677993) 1677993..1678058 + 66 NuclAT_18 - -
- (1677993) 1677993..1678058 + 66 NuclAT_18 - -
- (1677993) 1677993..1678058 + 66 NuclAT_19 - -
- (1677993) 1677993..1678058 + 66 NuclAT_19 - -
- (1677993) 1677993..1678058 + 66 NuclAT_19 - -
- (1677993) 1677993..1678058 + 66 NuclAT_19 - -
- (1677993) 1677993..1678058 + 66 NuclAT_20 - -
- (1677993) 1677993..1678058 + 66 NuclAT_20 - -
- (1677993) 1677993..1678058 + 66 NuclAT_20 - -
- (1677993) 1677993..1678058 + 66 NuclAT_20 - -
- (1677993) 1677993..1678058 + 66 NuclAT_21 - -
- (1677993) 1677993..1678058 + 66 NuclAT_21 - -
- (1677993) 1677993..1678058 + 66 NuclAT_21 - -
- (1677993) 1677993..1678058 + 66 NuclAT_21 - -
- (1677993) 1677993..1678058 + 66 NuclAT_22 - -
- (1677993) 1677993..1678058 + 66 NuclAT_22 - -
- (1677993) 1677993..1678058 + 66 NuclAT_22 - -
- (1677993) 1677993..1678058 + 66 NuclAT_22 - -
- (1677993) 1677993..1678058 + 66 NuclAT_23 - -
- (1677993) 1677993..1678058 + 66 NuclAT_23 - -
- (1677993) 1677993..1678058 + 66 NuclAT_23 - -
- (1677993) 1677993..1678058 + 66 NuclAT_23 - -
HH202_RS08475 (1678348) 1678348..1679448 - 1101 WP_000063608.1 sodium-potassium/proton antiporter ChaA -
HH202_RS08480 (1679718) 1679718..1679957 + 240 WP_000120702.1 putative cation transport regulator ChaB -
HH202_RS08485 (1680106) 1680106..1680801 + 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
HH202_RS08490 (1680845) 1680845..1681198 - 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
HH202_RS08495 (1681383) 1681383..1682777 + 1395 WP_000086187.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4040.89 Da        Isoelectric Point: 12.5163

>T154646 WP_001531632.1 NZ_CP051659:c1677943-1677836 [Escherichia coli]
MTLAQFAMIFWHNLAAPILAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T154646 NZ_CP068195:c883269-882982 [Acinetobacter johnsonii]
ATGGAACAGTATTTTGAATGGGATGAGGCTAAGAATCGAAAGAAACAGAAAAAGCATGATATCTCTTTTGAAACTGCAAG
CCTTGTATTTGAAGATCCTCTGCGGATCTCAATCCAAGACAGACATACCAATGGCGAAGAACGTTGGCAAACCATTGGTA
GGGTAAAAGGCGTACTAATGCTGTTAGTTGCTCACACCATCTTTGATGAAGATGACTGTGAAATCATACGAATTATTAGT
GCAAGACAAGTCACTAAAGCGGAGCGAAATCAATATGAGCATGGTTAG

Antitoxin


Download         Length: 67 bp

>AT154646 NZ_CP051659:1677991-1678057 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTGTACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A1U9U3P9

Antitoxin

Download structure file

References