Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2879597..2879817 Replicon chromosome
Accession NZ_CP049979
Organism Escherichia coli strain IBS28

Toxin (Protein)


Gene name ldrD Uniprot ID B7LGX8
Locus tag HAP53_RS13630 Protein ID WP_000170965.1
Coordinates 2879597..2879704 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2879751..2879817 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
HAP53_RS13600 2875452..2876285 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
HAP53_RS13605 2876282..2876674 + 393 WP_000200392.1 invasion regulator SirB2 -
HAP53_RS13610 2876678..2877487 + 810 WP_001257044.1 invasion regulator SirB1 -
HAP53_RS13615 2877523..2878377 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
HAP53_RS13620 2878526..2878633 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2878681..2878747 + 67 NuclAT_48 - -
- 2878681..2878747 + 67 NuclAT_48 - -
- 2878681..2878747 + 67 NuclAT_48 - -
- 2878681..2878747 + 67 NuclAT_48 - -
- 2878681..2878747 + 67 NuclAT_51 - -
- 2878681..2878747 + 67 NuclAT_51 - -
- 2878681..2878747 + 67 NuclAT_51 - -
- 2878681..2878747 + 67 NuclAT_51 - -
- 2878681..2878747 + 67 NuclAT_54 - -
- 2878681..2878747 + 67 NuclAT_54 - -
- 2878681..2878747 + 67 NuclAT_54 - -
- 2878681..2878747 + 67 NuclAT_54 - -
- 2878683..2878746 + 64 NuclAT_13 - -
- 2878683..2878746 + 64 NuclAT_13 - -
- 2878683..2878746 + 64 NuclAT_13 - -
- 2878683..2878746 + 64 NuclAT_13 - -
- 2878683..2878746 + 64 NuclAT_16 - -
- 2878683..2878746 + 64 NuclAT_16 - -
- 2878683..2878746 + 64 NuclAT_16 - -
- 2878683..2878746 + 64 NuclAT_16 - -
- 2878683..2878746 + 64 NuclAT_19 - -
- 2878683..2878746 + 64 NuclAT_19 - -
- 2878683..2878746 + 64 NuclAT_19 - -
- 2878683..2878746 + 64 NuclAT_19 - -
- 2878683..2878746 + 64 NuclAT_22 - -
- 2878683..2878746 + 64 NuclAT_22 - -
- 2878683..2878746 + 64 NuclAT_22 - -
- 2878683..2878746 + 64 NuclAT_22 - -
- 2878683..2878746 + 64 NuclAT_25 - -
- 2878683..2878746 + 64 NuclAT_25 - -
- 2878683..2878746 + 64 NuclAT_25 - -
- 2878683..2878746 + 64 NuclAT_25 - -
- 2878683..2878746 + 64 NuclAT_28 - -
- 2878683..2878746 + 64 NuclAT_28 - -
- 2878683..2878746 + 64 NuclAT_28 - -
- 2878683..2878746 + 64 NuclAT_28 - -
- 2878683..2878748 + 66 NuclAT_31 - -
- 2878683..2878748 + 66 NuclAT_31 - -
- 2878683..2878748 + 66 NuclAT_31 - -
- 2878683..2878748 + 66 NuclAT_31 - -
- 2878683..2878748 + 66 NuclAT_34 - -
- 2878683..2878748 + 66 NuclAT_34 - -
- 2878683..2878748 + 66 NuclAT_34 - -
- 2878683..2878748 + 66 NuclAT_34 - -
- 2878683..2878748 + 66 NuclAT_37 - -
- 2878683..2878748 + 66 NuclAT_37 - -
- 2878683..2878748 + 66 NuclAT_37 - -
- 2878683..2878748 + 66 NuclAT_37 - -
- 2878683..2878748 + 66 NuclAT_40 - -
- 2878683..2878748 + 66 NuclAT_40 - -
- 2878683..2878748 + 66 NuclAT_40 - -
- 2878683..2878748 + 66 NuclAT_40 - -
- 2878683..2878748 + 66 NuclAT_43 - -
- 2878683..2878748 + 66 NuclAT_43 - -
- 2878683..2878748 + 66 NuclAT_43 - -
- 2878683..2878748 + 66 NuclAT_43 - -
- 2878683..2878748 + 66 NuclAT_46 - -
- 2878683..2878748 + 66 NuclAT_46 - -
- 2878683..2878748 + 66 NuclAT_46 - -
- 2878683..2878748 + 66 NuclAT_46 - -
HAP53_RS13625 2879061..2879168 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2879221..2879282 + 62 NuclAT_14 - -
- 2879221..2879282 + 62 NuclAT_14 - -
- 2879221..2879282 + 62 NuclAT_14 - -
- 2879221..2879282 + 62 NuclAT_14 - -
- 2879221..2879282 + 62 NuclAT_17 - -
- 2879221..2879282 + 62 NuclAT_17 - -
- 2879221..2879282 + 62 NuclAT_17 - -
- 2879221..2879282 + 62 NuclAT_17 - -
- 2879221..2879282 + 62 NuclAT_20 - -
- 2879221..2879282 + 62 NuclAT_20 - -
- 2879221..2879282 + 62 NuclAT_20 - -
- 2879221..2879282 + 62 NuclAT_20 - -
- 2879221..2879282 + 62 NuclAT_23 - -
- 2879221..2879282 + 62 NuclAT_23 - -
- 2879221..2879282 + 62 NuclAT_23 - -
- 2879221..2879282 + 62 NuclAT_23 - -
- 2879221..2879282 + 62 NuclAT_26 - -
- 2879221..2879282 + 62 NuclAT_26 - -
- 2879221..2879282 + 62 NuclAT_26 - -
- 2879221..2879282 + 62 NuclAT_26 - -
- 2879221..2879282 + 62 NuclAT_29 - -
- 2879221..2879282 + 62 NuclAT_29 - -
- 2879221..2879282 + 62 NuclAT_29 - -
- 2879221..2879282 + 62 NuclAT_29 - -
- 2879221..2879283 + 63 NuclAT_49 - -
- 2879221..2879283 + 63 NuclAT_49 - -
- 2879221..2879283 + 63 NuclAT_49 - -
- 2879221..2879283 + 63 NuclAT_49 - -
- 2879221..2879283 + 63 NuclAT_52 - -
- 2879221..2879283 + 63 NuclAT_52 - -
- 2879221..2879283 + 63 NuclAT_52 - -
- 2879221..2879283 + 63 NuclAT_52 - -
- 2879221..2879283 + 63 NuclAT_55 - -
- 2879221..2879283 + 63 NuclAT_55 - -
- 2879221..2879283 + 63 NuclAT_55 - -
- 2879221..2879283 + 63 NuclAT_55 - -
- 2879221..2879284 + 64 NuclAT_32 - -
- 2879221..2879284 + 64 NuclAT_32 - -
- 2879221..2879284 + 64 NuclAT_32 - -
- 2879221..2879284 + 64 NuclAT_32 - -
- 2879221..2879284 + 64 NuclAT_35 - -
- 2879221..2879284 + 64 NuclAT_35 - -
- 2879221..2879284 + 64 NuclAT_35 - -
- 2879221..2879284 + 64 NuclAT_35 - -
- 2879221..2879284 + 64 NuclAT_38 - -
- 2879221..2879284 + 64 NuclAT_38 - -
- 2879221..2879284 + 64 NuclAT_38 - -
- 2879221..2879284 + 64 NuclAT_38 - -
- 2879221..2879284 + 64 NuclAT_41 - -
- 2879221..2879284 + 64 NuclAT_41 - -
- 2879221..2879284 + 64 NuclAT_41 - -
- 2879221..2879284 + 64 NuclAT_41 - -
- 2879221..2879284 + 64 NuclAT_44 - -
- 2879221..2879284 + 64 NuclAT_44 - -
- 2879221..2879284 + 64 NuclAT_44 - -
- 2879221..2879284 + 64 NuclAT_44 - -
- 2879221..2879284 + 64 NuclAT_47 - -
- 2879221..2879284 + 64 NuclAT_47 - -
- 2879221..2879284 + 64 NuclAT_47 - -
- 2879221..2879284 + 64 NuclAT_47 - -
HAP53_RS13630 2879597..2879704 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2879751..2879817 + 67 - - Antitoxin
HAP53_RS13635 2880109..2881209 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
HAP53_RS13640 2881479..2881709 + 231 WP_001146442.1 putative cation transport regulator ChaB -
HAP53_RS13645 2881867..2882562 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
HAP53_RS13650 2882606..2882959 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
HAP53_RS13655 2883144..2884538 + 1395 WP_000086201.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4001.77 Da        Isoelectric Point: 11.4779

>T151944 WP_000170965.1 NZ_CP049979:c2879704-2879597 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T151944 NZ_CP065846:828535-828945 [Klebsiella quasipneumoniae]
GTGGTCCTGTGGCAATCTGATCTCCGTATCTCCTGGCGCGCGCAGTGGTTTTCTCTGCTGCTCCACGGCGTTGTGGCGGC
GCTGGTGCTGCTGGTTCCCTGGCCGTTAAGCTACACCCCGATCTGGCTGCTGCTGCTGTCGCTGGTGGTCTTTGACTGTG
TGCGCAGCCAGCGACGGATCCATGCCCGTCGCGGGGAGATAAAACTGCTCACCGATTCCCGGCTGCGCTGGCAAAACGCC
GACTGGGAGATCCTCGGGACGCCGTGGGTCATCAACAGCGGAATGCTGCTGCGTTTGCGCCATGTCGATACCCGACGCGG
TCAGCATCTGTGGCTGGCGGCGGACAGCATGGATGCCGGAGAGTGGCGGGACCTGCGCCGGCTGGTGCTGCAAAAACCGG
CGCAGGAGTAA

Antitoxin


Download         Length: 67 bp

>AT151944 NZ_CP049979:2879751-2879817 [Escherichia coli]
TGTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y029

Antitoxin

Download structure file

References