Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-agrB/Ldr(toxin)
Location 330706..330927 Replicon chromosome
Accession NZ_CP048025
Organism Escherichia coli strain GZEC065

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag GWG09_RS01655 Protein ID WP_000170954.1
Coordinates 330706..330813 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name agrB
Locus tag -
Coordinates 330861..330927 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
GWG09_RS01630 326550..327632 + 1083 WP_000804726.1 peptide chain release factor 1 -
GWG09_RS01635 327632..328465 + 834 WP_000456469.1 peptide chain release factor N(5)-glutamine methyltransferase -
GWG09_RS01640 328462..328854 + 393 WP_000200378.1 invasion regulator SirB2 -
GWG09_RS01645 328858..329667 + 810 WP_001257044.1 invasion regulator SirB1 -
GWG09_RS01650 329703..330557 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
GWG09_RS01655 330706..330813 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 330861..330927 + 67 NuclAT_12 - Antitoxin
- 330861..330927 + 67 NuclAT_12 - Antitoxin
- 330861..330927 + 67 NuclAT_12 - Antitoxin
- 330861..330927 + 67 NuclAT_12 - Antitoxin
- 330861..330927 + 67 NuclAT_15 - Antitoxin
- 330861..330927 + 67 NuclAT_15 - Antitoxin
- 330861..330927 + 67 NuclAT_15 - Antitoxin
- 330861..330927 + 67 NuclAT_15 - Antitoxin
- 330861..330927 + 67 NuclAT_18 - Antitoxin
- 330861..330927 + 67 NuclAT_18 - Antitoxin
- 330861..330927 + 67 NuclAT_18 - Antitoxin
- 330861..330927 + 67 NuclAT_18 - Antitoxin
- 330861..330927 + 67 NuclAT_21 - Antitoxin
- 330861..330927 + 67 NuclAT_21 - Antitoxin
- 330861..330927 + 67 NuclAT_21 - Antitoxin
- 330861..330927 + 67 NuclAT_21 - Antitoxin
- 330861..330927 + 67 NuclAT_24 - Antitoxin
- 330861..330927 + 67 NuclAT_24 - Antitoxin
- 330861..330927 + 67 NuclAT_24 - Antitoxin
- 330861..330927 + 67 NuclAT_24 - Antitoxin
- 330861..330927 + 67 NuclAT_27 - Antitoxin
- 330861..330927 + 67 NuclAT_27 - Antitoxin
- 330861..330927 + 67 NuclAT_27 - Antitoxin
- 330861..330927 + 67 NuclAT_27 - Antitoxin
- 330863..330926 + 64 NuclAT_32 - -
- 330863..330926 + 64 NuclAT_32 - -
- 330863..330926 + 64 NuclAT_32 - -
- 330863..330926 + 64 NuclAT_32 - -
- 330863..330926 + 64 NuclAT_35 - -
- 330863..330926 + 64 NuclAT_35 - -
- 330863..330926 + 64 NuclAT_35 - -
- 330863..330926 + 64 NuclAT_35 - -
- 330863..330926 + 64 NuclAT_38 - -
- 330863..330926 + 64 NuclAT_38 - -
- 330863..330926 + 64 NuclAT_38 - -
- 330863..330926 + 64 NuclAT_38 - -
- 330863..330926 + 64 NuclAT_41 - -
- 330863..330926 + 64 NuclAT_41 - -
- 330863..330926 + 64 NuclAT_41 - -
- 330863..330926 + 64 NuclAT_41 - -
- 330863..330926 + 64 NuclAT_44 - -
- 330863..330926 + 64 NuclAT_44 - -
- 330863..330926 + 64 NuclAT_44 - -
- 330863..330926 + 64 NuclAT_44 - -
- 330863..330926 + 64 NuclAT_47 - -
- 330863..330926 + 64 NuclAT_47 - -
- 330863..330926 + 64 NuclAT_47 - -
- 330863..330926 + 64 NuclAT_47 - -
GWG09_RS01660 331241..331348 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 331401..331462 + 62 NuclAT_30 - -
- 331401..331462 + 62 NuclAT_30 - -
- 331401..331462 + 62 NuclAT_30 - -
- 331401..331462 + 62 NuclAT_30 - -
- 331401..331462 + 62 NuclAT_33 - -
- 331401..331462 + 62 NuclAT_33 - -
- 331401..331462 + 62 NuclAT_33 - -
- 331401..331462 + 62 NuclAT_33 - -
- 331401..331462 + 62 NuclAT_36 - -
- 331401..331462 + 62 NuclAT_36 - -
- 331401..331462 + 62 NuclAT_36 - -
- 331401..331462 + 62 NuclAT_36 - -
- 331401..331462 + 62 NuclAT_39 - -
- 331401..331462 + 62 NuclAT_39 - -
- 331401..331462 + 62 NuclAT_39 - -
- 331401..331462 + 62 NuclAT_39 - -
- 331401..331462 + 62 NuclAT_42 - -
- 331401..331462 + 62 NuclAT_42 - -
- 331401..331462 + 62 NuclAT_42 - -
- 331401..331462 + 62 NuclAT_42 - -
- 331401..331462 + 62 NuclAT_45 - -
- 331401..331462 + 62 NuclAT_45 - -
- 331401..331462 + 62 NuclAT_45 - -
- 331401..331462 + 62 NuclAT_45 - -
- 331401..331463 + 63 NuclAT_13 - -
- 331401..331463 + 63 NuclAT_13 - -
- 331401..331463 + 63 NuclAT_13 - -
- 331401..331463 + 63 NuclAT_13 - -
- 331401..331463 + 63 NuclAT_16 - -
- 331401..331463 + 63 NuclAT_16 - -
- 331401..331463 + 63 NuclAT_16 - -
- 331401..331463 + 63 NuclAT_16 - -
- 331401..331463 + 63 NuclAT_19 - -
- 331401..331463 + 63 NuclAT_19 - -
- 331401..331463 + 63 NuclAT_19 - -
- 331401..331463 + 63 NuclAT_19 - -
- 331401..331463 + 63 NuclAT_22 - -
- 331401..331463 + 63 NuclAT_22 - -
- 331401..331463 + 63 NuclAT_22 - -
- 331401..331463 + 63 NuclAT_22 - -
- 331401..331463 + 63 NuclAT_25 - -
- 331401..331463 + 63 NuclAT_25 - -
- 331401..331463 + 63 NuclAT_25 - -
- 331401..331463 + 63 NuclAT_25 - -
- 331401..331463 + 63 NuclAT_28 - -
- 331401..331463 + 63 NuclAT_28 - -
- 331401..331463 + 63 NuclAT_28 - -
- 331401..331463 + 63 NuclAT_28 - -
- 331401..331464 + 64 NuclAT_48 - -
- 331401..331464 + 64 NuclAT_48 - -
- 331401..331464 + 64 NuclAT_48 - -
- 331401..331464 + 64 NuclAT_48 - -
- 331401..331464 + 64 NuclAT_50 - -
- 331401..331464 + 64 NuclAT_50 - -
- 331401..331464 + 64 NuclAT_50 - -
- 331401..331464 + 64 NuclAT_50 - -
- 331401..331464 + 64 NuclAT_52 - -
- 331401..331464 + 64 NuclAT_52 - -
- 331401..331464 + 64 NuclAT_52 - -
- 331401..331464 + 64 NuclAT_52 - -
GWG09_RS24560 331777..331884 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 331937..331998 + 62 NuclAT_31 - -
- 331937..331998 + 62 NuclAT_31 - -
- 331937..331998 + 62 NuclAT_31 - -
- 331937..331998 + 62 NuclAT_31 - -
- 331937..331998 + 62 NuclAT_34 - -
- 331937..331998 + 62 NuclAT_34 - -
- 331937..331998 + 62 NuclAT_34 - -
- 331937..331998 + 62 NuclAT_34 - -
- 331937..331998 + 62 NuclAT_37 - -
- 331937..331998 + 62 NuclAT_37 - -
- 331937..331998 + 62 NuclAT_37 - -
- 331937..331998 + 62 NuclAT_37 - -
- 331937..331998 + 62 NuclAT_40 - -
- 331937..331998 + 62 NuclAT_40 - -
- 331937..331998 + 62 NuclAT_40 - -
- 331937..331998 + 62 NuclAT_40 - -
- 331937..331998 + 62 NuclAT_43 - -
- 331937..331998 + 62 NuclAT_43 - -
- 331937..331998 + 62 NuclAT_43 - -
- 331937..331998 + 62 NuclAT_43 - -
- 331937..331998 + 62 NuclAT_46 - -
- 331937..331998 + 62 NuclAT_46 - -
- 331937..331998 + 62 NuclAT_46 - -
- 331937..331998 + 62 NuclAT_46 - -
- 331937..331999 + 63 NuclAT_14 - -
- 331937..331999 + 63 NuclAT_14 - -
- 331937..331999 + 63 NuclAT_14 - -
- 331937..331999 + 63 NuclAT_14 - -
- 331937..331999 + 63 NuclAT_17 - -
- 331937..331999 + 63 NuclAT_17 - -
- 331937..331999 + 63 NuclAT_17 - -
- 331937..331999 + 63 NuclAT_17 - -
- 331937..331999 + 63 NuclAT_20 - -
- 331937..331999 + 63 NuclAT_20 - -
- 331937..331999 + 63 NuclAT_20 - -
- 331937..331999 + 63 NuclAT_20 - -
- 331937..331999 + 63 NuclAT_23 - -
- 331937..331999 + 63 NuclAT_23 - -
- 331937..331999 + 63 NuclAT_23 - -
- 331937..331999 + 63 NuclAT_23 - -
- 331937..331999 + 63 NuclAT_26 - -
- 331937..331999 + 63 NuclAT_26 - -
- 331937..331999 + 63 NuclAT_26 - -
- 331937..331999 + 63 NuclAT_26 - -
- 331937..331999 + 63 NuclAT_29 - -
- 331937..331999 + 63 NuclAT_29 - -
- 331937..331999 + 63 NuclAT_29 - -
- 331937..331999 + 63 NuclAT_29 - -
- 331937..332000 + 64 NuclAT_49 - -
- 331937..332000 + 64 NuclAT_49 - -
- 331937..332000 + 64 NuclAT_49 - -
- 331937..332000 + 64 NuclAT_49 - -
- 331937..332000 + 64 NuclAT_51 - -
- 331937..332000 + 64 NuclAT_51 - -
- 331937..332000 + 64 NuclAT_51 - -
- 331937..332000 + 64 NuclAT_51 - -
- 331937..332000 + 64 NuclAT_53 - -
- 331937..332000 + 64 NuclAT_53 - -
- 331937..332000 + 64 NuclAT_53 - -
- 331937..332000 + 64 NuclAT_53 - -
GWG09_RS01670 332290..333390 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
GWG09_RS01675 333660..333890 + 231 WP_001146442.1 putative cation transport regulator ChaB -
GWG09_RS01680 334048..334743 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
GWG09_RS01685 334787..335140 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T148702 WP_000170954.1 NZ_CP048025:c330813-330706 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T148702 NZ_CP063851:c2560652-2560269 [Klebsiella pneumoniae]
ATGACCTCCGGATCTGCGCTTTTTGATACCAATATTCTTATTGATTTATTTAGCGGGCATCGCGAAGCCAAACAGGCGCT
GGAGGCCTGGCCACCGCAGAATGCGATCAGTCTGATTACCTGGATGGAGGTGATGGTTGGCGCTAAAAAATATCACCAGG
AGCAGCGCACGCGAATGGCGCTGAGCACCTTTAATATCATTAACATCTCACAGGATATTGCAGAGCGAAGCGTTGCGCTG
CGGCAGGAGTATAAGCTTAAGCTGCCGGATGCCATCATTCTGGCGACGGCGCAACTCCATCGTCTGGAACTAATTACGCG
GAATACGAAGGATTTTGCCGGTATTCCTGGCGTAGTCACGCCGTACGAAATCCACCCTGAATAA

Antitoxin


Download         Length: 67 bp

>AT148702 NZ_CP048025:330861-330927 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References