Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 3001544..3001801 | Replicon | chromosome |
| Accession | NZ_CP047576 | ||
| Organism | Escherichia coli strain 94EC | ||
Toxin (Protein)
| Gene name | hokA | Uniprot ID | E9T8R9 |
| Locus tag | GUJ28_RS14275 | Protein ID | WP_001135746.1 |
| Coordinates | 3001649..3001801 (+) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | sokA | ||
| Locus tag | - | ||
| Coordinates | 3001544..3001598 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GUJ28_RS14255 | 2996769..2997764 | - | 996 | WP_001182653.1 | O-acetyltransferase WecH | - |
| GUJ28_RS14260 | 2997939..2998238 | + | 300 | WP_000980111.1 | YsaB family lipoprotein | - |
| GUJ28_RS14265 | 2998333..2999244 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| GUJ28_RS14270 | 2999254..3001323 | + | 2070 | WP_001291774.1 | glycine--tRNA ligase subunit beta | - |
| - | 3001544..3001598 | - | 55 | - | - | Antitoxin |
| GUJ28_RS14275 | 3001649..3001801 | + | 153 | WP_001135746.1 | type I toxin-antitoxin system toxin HokA | Toxin |
| GUJ28_RS14280 | 3001989..3002201 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
| GUJ28_RS14285 | 3002482..3002772 | - | 291 | WP_000455798.1 | HTH-type transcriptional regulator | - |
| GUJ28_RS14290 | 3003206..3003916 | + | 711 | WP_000190516.1 | DUF3053 domain-containing protein | - |
| GUJ28_RS14295 | 3003966..3004940 | - | 975 | WP_000805027.1 | glyoxylate/hydroxypyruvate reductase GhrB | - |
| GUJ28_RS14300 | 3005044..3005703 | - | 660 | WP_000747625.1 | OmpA family lipoprotein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5928.14 Da Isoelectric Point: 7.7146
>T146777 WP_001135746.1 NZ_CP047576:3001649-3001801 [Escherichia coli]
MPQKYRLLSLIVICYTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
MPQKYRLLSLIVICYTLLFFTWMIRDSLCELHIKQGSYELAAFLACNLKE
Download Length: 153 bp
>T146777 NZ_CP062782:283379-283486 [Escherichia coli O157:H7]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGTATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 55 bp
>AT146777 NZ_CP047576:c3001598-3001544 [Escherichia coli]
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTCAGGCATAGGGTAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|