Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1377235..1377456 | Replicon | chromosome |
| Accession | NZ_CP047405 | ||
| Organism | Escherichia coli strain MS6193 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | MS6193_RS06615 | Protein ID | WP_000170954.1 |
| Coordinates | 1377235..1377342 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1377390..1377456 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| MS6193_RS06590 | 1373079..1374161 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| MS6193_RS06595 | 1374161..1374994 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| MS6193_RS06600 | 1374991..1375383 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| MS6193_RS06605 | 1375387..1376196 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| MS6193_RS06610 | 1376232..1377086 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| MS6193_RS06615 | 1377235..1377342 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 1377390..1377456 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_27 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_29 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_31 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_33 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_35 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1377390..1377456 | + | 67 | NuclAT_37 | - | Antitoxin |
| - | 1377392..1377455 | + | 64 | NuclAT_40 | - | - |
| - | 1377392..1377455 | + | 64 | NuclAT_40 | - | - |
| - | 1377392..1377455 | + | 64 | NuclAT_40 | - | - |
| - | 1377392..1377455 | + | 64 | NuclAT_40 | - | - |
| - | 1377392..1377455 | + | 64 | NuclAT_42 | - | - |
| - | 1377392..1377455 | + | 64 | NuclAT_42 | - | - |
| - | 1377392..1377455 | + | 64 | NuclAT_42 | - | - |
| - | 1377392..1377455 | + | 64 | NuclAT_42 | - | - |
| MS6193_RS06620 | 1377770..1377877 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1377930..1377991 | + | 62 | NuclAT_39 | - | - |
| - | 1377930..1377991 | + | 62 | NuclAT_39 | - | - |
| - | 1377930..1377991 | + | 62 | NuclAT_39 | - | - |
| - | 1377930..1377991 | + | 62 | NuclAT_39 | - | - |
| - | 1377930..1377991 | + | 62 | NuclAT_41 | - | - |
| - | 1377930..1377991 | + | 62 | NuclAT_41 | - | - |
| - | 1377930..1377991 | + | 62 | NuclAT_41 | - | - |
| - | 1377930..1377991 | + | 62 | NuclAT_41 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_28 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_28 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_28 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_28 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_30 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_30 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_30 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_30 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_32 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_32 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_32 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_32 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_34 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_34 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_34 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_34 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_36 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_36 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_36 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_36 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_38 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_38 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_38 | - | - |
| - | 1377930..1377992 | + | 63 | NuclAT_38 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_16 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_16 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_16 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_16 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_18 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_18 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_18 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_18 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_20 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_20 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_20 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_20 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_22 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_22 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_22 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_22 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_24 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_24 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_24 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_24 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_26 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_26 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_26 | - | - |
| - | 1377930..1377993 | + | 64 | NuclAT_26 | - | - |
| MS6193_RS06625 | 1378306..1378413 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1378461..1378528 | + | 68 | NuclAT_15 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_15 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_15 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_15 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_17 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_17 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_17 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_17 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_19 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_19 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_19 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_19 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_21 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_21 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_21 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_21 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_23 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_23 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_23 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_23 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_25 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_25 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_25 | - | - |
| - | 1378461..1378528 | + | 68 | NuclAT_25 | - | - |
| MS6193_RS06630 | 1378818..1379918 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| MS6193_RS06635 | 1380188..1380418 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| MS6193_RS06640 | 1380576..1381271 | + | 696 | WP_001355927.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| MS6193_RS06645 | 1381315..1381668 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T146156 WP_000170954.1 NZ_CP047405:c1377342-1377235 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T146156 NZ_CP062727:365362-365637 [Escherichia coli O157:H7]
ATGAGAACCAAGGTACAGGCTTTACGGAAGAAACAAAAAAATACATTGGATCAAATATTTAAAACTCCTGTTCCTCAAGG
GATCAAGTGGTCTGATATAGAGTCACTGGTTAAAGCATTAGGCGGAGAAATTAAGGAAGGAAGAGGTTCGCGTTGTAAGC
TCATACTAAATATGAGCGTTGCGTGTTTCCATCGGCCTCATCCGTCGCCAGATACCGATAAAGGCGCTGTAGAAAGCGTG
CGTGACTGGTTACTAAGTATAGGGGTAAAACCATGA
ATGAGAACCAAGGTACAGGCTTTACGGAAGAAACAAAAAAATACATTGGATCAAATATTTAAAACTCCTGTTCCTCAAGG
GATCAAGTGGTCTGATATAGAGTCACTGGTTAAAGCATTAGGCGGAGAAATTAAGGAAGGAAGAGGTTCGCGTTGTAAGC
TCATACTAAATATGAGCGTTGCGTGTTTCCATCGGCCTCATCCGTCGCCAGATACCGATAAAGGCGCTGTAGAAAGCGTG
CGTGACTGGTTACTAAGTATAGGGGTAAAACCATGA
Antitoxin
Download Length: 67 bp
>AT146156 NZ_CP047405:1377390-1377456 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|