Detailed information of TA system    

insolicoBioinformatically predicted

Overview


TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1377235..1377456 Replicon chromosome
Accession NZ_CP047405
Organism Escherichia coli strain MS6193

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag MS6193_RS06615 Protein ID WP_000170954.1
Coordinates 1377235..1377342 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1377390..1377456 (+)

Genomic Context


Locus tag Coordinates Strand Size (bp) Protein ID Product Description
MS6193_RS06590 1373079..1374161 + 1083 WP_000804726.1 peptide chain release factor 1 -
MS6193_RS06595 1374161..1374994 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
MS6193_RS06600 1374991..1375383 + 393 WP_000200378.1 invasion regulator SirB2 -
MS6193_RS06605 1375387..1376196 + 810 WP_001257044.1 invasion regulator SirB1 -
MS6193_RS06610 1376232..1377086 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
MS6193_RS06615 1377235..1377342 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 1377390..1377456 + 67 NuclAT_27 - Antitoxin
- 1377390..1377456 + 67 NuclAT_27 - Antitoxin
- 1377390..1377456 + 67 NuclAT_27 - Antitoxin
- 1377390..1377456 + 67 NuclAT_27 - Antitoxin
- 1377390..1377456 + 67 NuclAT_29 - Antitoxin
- 1377390..1377456 + 67 NuclAT_29 - Antitoxin
- 1377390..1377456 + 67 NuclAT_29 - Antitoxin
- 1377390..1377456 + 67 NuclAT_29 - Antitoxin
- 1377390..1377456 + 67 NuclAT_31 - Antitoxin
- 1377390..1377456 + 67 NuclAT_31 - Antitoxin
- 1377390..1377456 + 67 NuclAT_31 - Antitoxin
- 1377390..1377456 + 67 NuclAT_31 - Antitoxin
- 1377390..1377456 + 67 NuclAT_33 - Antitoxin
- 1377390..1377456 + 67 NuclAT_33 - Antitoxin
- 1377390..1377456 + 67 NuclAT_33 - Antitoxin
- 1377390..1377456 + 67 NuclAT_33 - Antitoxin
- 1377390..1377456 + 67 NuclAT_35 - Antitoxin
- 1377390..1377456 + 67 NuclAT_35 - Antitoxin
- 1377390..1377456 + 67 NuclAT_35 - Antitoxin
- 1377390..1377456 + 67 NuclAT_35 - Antitoxin
- 1377390..1377456 + 67 NuclAT_37 - Antitoxin
- 1377390..1377456 + 67 NuclAT_37 - Antitoxin
- 1377390..1377456 + 67 NuclAT_37 - Antitoxin
- 1377390..1377456 + 67 NuclAT_37 - Antitoxin
- 1377392..1377455 + 64 NuclAT_40 - -
- 1377392..1377455 + 64 NuclAT_40 - -
- 1377392..1377455 + 64 NuclAT_40 - -
- 1377392..1377455 + 64 NuclAT_40 - -
- 1377392..1377455 + 64 NuclAT_42 - -
- 1377392..1377455 + 64 NuclAT_42 - -
- 1377392..1377455 + 64 NuclAT_42 - -
- 1377392..1377455 + 64 NuclAT_42 - -
MS6193_RS06620 1377770..1377877 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1377930..1377991 + 62 NuclAT_39 - -
- 1377930..1377991 + 62 NuclAT_39 - -
- 1377930..1377991 + 62 NuclAT_39 - -
- 1377930..1377991 + 62 NuclAT_39 - -
- 1377930..1377991 + 62 NuclAT_41 - -
- 1377930..1377991 + 62 NuclAT_41 - -
- 1377930..1377991 + 62 NuclAT_41 - -
- 1377930..1377991 + 62 NuclAT_41 - -
- 1377930..1377992 + 63 NuclAT_28 - -
- 1377930..1377992 + 63 NuclAT_28 - -
- 1377930..1377992 + 63 NuclAT_28 - -
- 1377930..1377992 + 63 NuclAT_28 - -
- 1377930..1377992 + 63 NuclAT_30 - -
- 1377930..1377992 + 63 NuclAT_30 - -
- 1377930..1377992 + 63 NuclAT_30 - -
- 1377930..1377992 + 63 NuclAT_30 - -
- 1377930..1377992 + 63 NuclAT_32 - -
- 1377930..1377992 + 63 NuclAT_32 - -
- 1377930..1377992 + 63 NuclAT_32 - -
- 1377930..1377992 + 63 NuclAT_32 - -
- 1377930..1377992 + 63 NuclAT_34 - -
- 1377930..1377992 + 63 NuclAT_34 - -
- 1377930..1377992 + 63 NuclAT_34 - -
- 1377930..1377992 + 63 NuclAT_34 - -
- 1377930..1377992 + 63 NuclAT_36 - -
- 1377930..1377992 + 63 NuclAT_36 - -
- 1377930..1377992 + 63 NuclAT_36 - -
- 1377930..1377992 + 63 NuclAT_36 - -
- 1377930..1377992 + 63 NuclAT_38 - -
- 1377930..1377992 + 63 NuclAT_38 - -
- 1377930..1377992 + 63 NuclAT_38 - -
- 1377930..1377992 + 63 NuclAT_38 - -
- 1377930..1377993 + 64 NuclAT_16 - -
- 1377930..1377993 + 64 NuclAT_16 - -
- 1377930..1377993 + 64 NuclAT_16 - -
- 1377930..1377993 + 64 NuclAT_16 - -
- 1377930..1377993 + 64 NuclAT_18 - -
- 1377930..1377993 + 64 NuclAT_18 - -
- 1377930..1377993 + 64 NuclAT_18 - -
- 1377930..1377993 + 64 NuclAT_18 - -
- 1377930..1377993 + 64 NuclAT_20 - -
- 1377930..1377993 + 64 NuclAT_20 - -
- 1377930..1377993 + 64 NuclAT_20 - -
- 1377930..1377993 + 64 NuclAT_20 - -
- 1377930..1377993 + 64 NuclAT_22 - -
- 1377930..1377993 + 64 NuclAT_22 - -
- 1377930..1377993 + 64 NuclAT_22 - -
- 1377930..1377993 + 64 NuclAT_22 - -
- 1377930..1377993 + 64 NuclAT_24 - -
- 1377930..1377993 + 64 NuclAT_24 - -
- 1377930..1377993 + 64 NuclAT_24 - -
- 1377930..1377993 + 64 NuclAT_24 - -
- 1377930..1377993 + 64 NuclAT_26 - -
- 1377930..1377993 + 64 NuclAT_26 - -
- 1377930..1377993 + 64 NuclAT_26 - -
- 1377930..1377993 + 64 NuclAT_26 - -
MS6193_RS06625 1378306..1378413 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 1378461..1378528 + 68 NuclAT_15 - -
- 1378461..1378528 + 68 NuclAT_15 - -
- 1378461..1378528 + 68 NuclAT_15 - -
- 1378461..1378528 + 68 NuclAT_15 - -
- 1378461..1378528 + 68 NuclAT_17 - -
- 1378461..1378528 + 68 NuclAT_17 - -
- 1378461..1378528 + 68 NuclAT_17 - -
- 1378461..1378528 + 68 NuclAT_17 - -
- 1378461..1378528 + 68 NuclAT_19 - -
- 1378461..1378528 + 68 NuclAT_19 - -
- 1378461..1378528 + 68 NuclAT_19 - -
- 1378461..1378528 + 68 NuclAT_19 - -
- 1378461..1378528 + 68 NuclAT_21 - -
- 1378461..1378528 + 68 NuclAT_21 - -
- 1378461..1378528 + 68 NuclAT_21 - -
- 1378461..1378528 + 68 NuclAT_21 - -
- 1378461..1378528 + 68 NuclAT_23 - -
- 1378461..1378528 + 68 NuclAT_23 - -
- 1378461..1378528 + 68 NuclAT_23 - -
- 1378461..1378528 + 68 NuclAT_23 - -
- 1378461..1378528 + 68 NuclAT_25 - -
- 1378461..1378528 + 68 NuclAT_25 - -
- 1378461..1378528 + 68 NuclAT_25 - -
- 1378461..1378528 + 68 NuclAT_25 - -
MS6193_RS06630 1378818..1379918 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
MS6193_RS06635 1380188..1380418 + 231 WP_001146442.1 putative cation transport regulator ChaB -
MS6193_RS06640 1380576..1381271 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
MS6193_RS06645 1381315..1381668 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs


MGE
detail
Similar
MGEs
Relative
position
MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains


Predicted by InterproScan

Toxin

(1-35)


Sequences


Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T146156 WP_000170954.1 NZ_CP047405:c1377342-1377235 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T146156 NZ_CP062727:365362-365637 [Escherichia coli O157:H7]
ATGAGAACCAAGGTACAGGCTTTACGGAAGAAACAAAAAAATACATTGGATCAAATATTTAAAACTCCTGTTCCTCAAGG
GATCAAGTGGTCTGATATAGAGTCACTGGTTAAAGCATTAGGCGGAGAAATTAAGGAAGGAAGAGGTTCGCGTTGTAAGC
TCATACTAAATATGAGCGTTGCGTGTTTCCATCGGCCTCATCCGTCGCCAGATACCGATAAAGGCGCTGTAGAAAGCGTG
CGTGACTGGTTACTAAGTATAGGGGTAAAACCATGA

Antitoxin


Download         Length: 67 bp

>AT146156 NZ_CP047405:1377390-1377456 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins


Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures


Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9


Antitoxin

Download structure file

References