Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2053435..2053657 | Replicon | chromosome |
| Accession | NZ_CP047127 | ||
| Organism | Escherichia coli K-12 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1E8T8 |
| Locus tag | GRF62_RS09785 | Protein ID | WP_000141634.1 |
| Coordinates | 2053550..2053657 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2053435..2053501 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| GRF62_RS09765 | 2048876..2049778 | + | 903 | WP_000084677.1 | dipeptide ABC transporter permease DppC | - |
| GRF62_RS09770 | 2049789..2050772 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| GRF62_RS09775 | 2050769..2051773 | + | 1005 | WP_000107012.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| GRF62_RS09780 | 2051803..2053074 | - | 1272 | WP_001295225.1 | transporter | - |
| - | 2053435..2053501 | - | 67 | - | - | Antitoxin |
| GRF62_RS09785 | 2053550..2053657 | + | 108 | WP_000141634.1 | type I toxin-antitoxin system toxic polypeptide LdrD | Toxin |
| GRF62_RS09790 | 2053744..2055423 | - | 1680 | WP_000191622.1 | cellulose biosynthesis protein BcsG | - |
| GRF62_RS09795 | 2055420..2055611 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| GRF62_RS09800 | 2055608..2057179 | - | 1572 | WP_001204931.1 | cellulose biosynthesis protein BcsE | - |
| GRF62_RS09805 | 2057452..2057640 | + | 189 | WP_001063318.1 | YhjR family protein | - |
| GRF62_RS09810 | 2057652..2058404 | + | 753 | Protein_1898 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3916.72 Da Isoelectric Point: 9.0157
>T145448 WP_000141634.1 NZ_CP047127:2053550-2053657 [Escherichia coli K-12]
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTFAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T145448 NZ_CP062386:c183502-183407 [Staphylococcus aureus]
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
GTGATGCTTATTTTCGTTCACATCATAGCACCAGTCATCAGTGGCTGTGCCATTGCGTTTTTTTCTTATTGGCTAAGTAG
ACGCAATACAAAATAG
Antitoxin
Download Length: 67 bp
>AT145448 NZ_CP047127:c2053501-2053435 [Escherichia coli K-12]
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
GTCTAGAGTCAAGATTAGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|