Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-istR/Ldr(toxin)
Location 2888085..2888306 Replicon chromosome
Accession NZ_CP043414
Organism Escherichia coli strain EC42405

Toxin (Protein)


Gene name ldrD Uniprot ID -
Locus tag FZN31_RS13760 Protein ID WP_123057329.1
Coordinates 2888199..2888306 (+) Length 36 a.a.

Antitoxin (RNA)


Gene name istR
Locus tag -
Coordinates 2888085..2888146 (-)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FZN31_RS13735 2883364..2884758 - 1395 WP_105277415.1 inverse autotransporter invasin YchO -
FZN31_RS13740 2884944..2885297 + 354 WP_001169659.1 DsrE/F sulfur relay family protein YchN -
FZN31_RS13745 2885341..2886036 - 696 WP_001295621.1 glutathione-specific gamma-glutamylcyclotransferase -
FZN31_RS13750 2886193..2886423 - 231 WP_001146444.1 putative cation transport regulator ChaB -
FZN31_RS13755 2886693..2887793 + 1101 WP_001306585.1 sodium-potassium/proton antiporter ChaA -
- 2888083..2888146 - 64 NuclAT_21 - -
- 2888083..2888146 - 64 NuclAT_21 - -
- 2888083..2888146 - 64 NuclAT_21 - -
- 2888083..2888146 - 64 NuclAT_21 - -
- 2888083..2888146 - 64 NuclAT_25 - -
- 2888083..2888146 - 64 NuclAT_25 - -
- 2888083..2888146 - 64 NuclAT_25 - -
- 2888083..2888146 - 64 NuclAT_25 - -
- 2888083..2888146 - 64 NuclAT_29 - -
- 2888083..2888146 - 64 NuclAT_29 - -
- 2888083..2888146 - 64 NuclAT_29 - -
- 2888083..2888146 - 64 NuclAT_29 - -
- 2888083..2888146 - 64 NuclAT_33 - -
- 2888083..2888146 - 64 NuclAT_33 - -
- 2888083..2888146 - 64 NuclAT_33 - -
- 2888083..2888146 - 64 NuclAT_33 - -
- 2888083..2888146 - 64 NuclAT_37 - -
- 2888083..2888146 - 64 NuclAT_37 - -
- 2888083..2888146 - 64 NuclAT_37 - -
- 2888083..2888146 - 64 NuclAT_37 - -
- 2888083..2888146 - 64 NuclAT_41 - -
- 2888083..2888146 - 64 NuclAT_41 - -
- 2888083..2888146 - 64 NuclAT_41 - -
- 2888083..2888146 - 64 NuclAT_41 - -
- 2888084..2888146 - 63 NuclAT_23 - -
- 2888084..2888146 - 63 NuclAT_23 - -
- 2888084..2888146 - 63 NuclAT_23 - -
- 2888084..2888146 - 63 NuclAT_23 - -
- 2888084..2888146 - 63 NuclAT_27 - -
- 2888084..2888146 - 63 NuclAT_27 - -
- 2888084..2888146 - 63 NuclAT_27 - -
- 2888084..2888146 - 63 NuclAT_27 - -
- 2888084..2888146 - 63 NuclAT_31 - -
- 2888084..2888146 - 63 NuclAT_31 - -
- 2888084..2888146 - 63 NuclAT_31 - -
- 2888084..2888146 - 63 NuclAT_31 - -
- 2888084..2888146 - 63 NuclAT_35 - -
- 2888084..2888146 - 63 NuclAT_35 - -
- 2888084..2888146 - 63 NuclAT_35 - -
- 2888084..2888146 - 63 NuclAT_35 - -
- 2888084..2888146 - 63 NuclAT_39 - -
- 2888084..2888146 - 63 NuclAT_39 - -
- 2888084..2888146 - 63 NuclAT_39 - -
- 2888084..2888146 - 63 NuclAT_39 - -
- 2888085..2888146 - 62 NuclAT_11 - Antitoxin
- 2888085..2888146 - 62 NuclAT_11 - Antitoxin
- 2888085..2888146 - 62 NuclAT_11 - Antitoxin
- 2888085..2888146 - 62 NuclAT_11 - Antitoxin
- 2888085..2888146 - 62 NuclAT_13 - Antitoxin
- 2888085..2888146 - 62 NuclAT_13 - Antitoxin
- 2888085..2888146 - 62 NuclAT_13 - Antitoxin
- 2888085..2888146 - 62 NuclAT_13 - Antitoxin
- 2888085..2888146 - 62 NuclAT_15 - Antitoxin
- 2888085..2888146 - 62 NuclAT_15 - Antitoxin
- 2888085..2888146 - 62 NuclAT_15 - Antitoxin
- 2888085..2888146 - 62 NuclAT_15 - Antitoxin
- 2888085..2888146 - 62 NuclAT_17 - Antitoxin
- 2888085..2888146 - 62 NuclAT_17 - Antitoxin
- 2888085..2888146 - 62 NuclAT_17 - Antitoxin
- 2888085..2888146 - 62 NuclAT_17 - Antitoxin
- 2888085..2888146 - 62 NuclAT_19 - Antitoxin
- 2888085..2888146 - 62 NuclAT_19 - Antitoxin
- 2888085..2888146 - 62 NuclAT_19 - Antitoxin
- 2888085..2888146 - 62 NuclAT_19 - Antitoxin
- 2888085..2888146 - 62 NuclAT_9 - Antitoxin
- 2888085..2888146 - 62 NuclAT_9 - Antitoxin
- 2888085..2888146 - 62 NuclAT_9 - Antitoxin
- 2888085..2888146 - 62 NuclAT_9 - Antitoxin
FZN31_RS13760 2888199..2888306 + 108 WP_123057329.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2888619..2888686 - 68 NuclAT_20 - -
- 2888619..2888686 - 68 NuclAT_20 - -
- 2888619..2888686 - 68 NuclAT_20 - -
- 2888619..2888686 - 68 NuclAT_20 - -
- 2888619..2888686 - 68 NuclAT_24 - -
- 2888619..2888686 - 68 NuclAT_24 - -
- 2888619..2888686 - 68 NuclAT_24 - -
- 2888619..2888686 - 68 NuclAT_24 - -
- 2888619..2888686 - 68 NuclAT_28 - -
- 2888619..2888686 - 68 NuclAT_28 - -
- 2888619..2888686 - 68 NuclAT_28 - -
- 2888619..2888686 - 68 NuclAT_28 - -
- 2888619..2888686 - 68 NuclAT_32 - -
- 2888619..2888686 - 68 NuclAT_32 - -
- 2888619..2888686 - 68 NuclAT_32 - -
- 2888619..2888686 - 68 NuclAT_32 - -
- 2888619..2888686 - 68 NuclAT_36 - -
- 2888619..2888686 - 68 NuclAT_36 - -
- 2888619..2888686 - 68 NuclAT_36 - -
- 2888619..2888686 - 68 NuclAT_36 - -
- 2888619..2888686 - 68 NuclAT_40 - -
- 2888619..2888686 - 68 NuclAT_40 - -
- 2888619..2888686 - 68 NuclAT_40 - -
- 2888619..2888686 - 68 NuclAT_40 - -
- 2888620..2888685 - 66 NuclAT_22 - -
- 2888620..2888685 - 66 NuclAT_22 - -
- 2888620..2888685 - 66 NuclAT_22 - -
- 2888620..2888685 - 66 NuclAT_22 - -
- 2888620..2888685 - 66 NuclAT_26 - -
- 2888620..2888685 - 66 NuclAT_26 - -
- 2888620..2888685 - 66 NuclAT_26 - -
- 2888620..2888685 - 66 NuclAT_26 - -
- 2888620..2888685 - 66 NuclAT_30 - -
- 2888620..2888685 - 66 NuclAT_30 - -
- 2888620..2888685 - 66 NuclAT_30 - -
- 2888620..2888685 - 66 NuclAT_30 - -
- 2888620..2888685 - 66 NuclAT_34 - -
- 2888620..2888685 - 66 NuclAT_34 - -
- 2888620..2888685 - 66 NuclAT_34 - -
- 2888620..2888685 - 66 NuclAT_34 - -
- 2888620..2888685 - 66 NuclAT_38 - -
- 2888620..2888685 - 66 NuclAT_38 - -
- 2888620..2888685 - 66 NuclAT_38 - -
- 2888620..2888685 - 66 NuclAT_38 - -
- 2888621..2888686 - 66 NuclAT_10 - -
- 2888621..2888686 - 66 NuclAT_10 - -
- 2888621..2888686 - 66 NuclAT_10 - -
- 2888621..2888686 - 66 NuclAT_10 - -
- 2888621..2888686 - 66 NuclAT_12 - -
- 2888621..2888686 - 66 NuclAT_12 - -
- 2888621..2888686 - 66 NuclAT_12 - -
- 2888621..2888686 - 66 NuclAT_12 - -
- 2888621..2888686 - 66 NuclAT_14 - -
- 2888621..2888686 - 66 NuclAT_14 - -
- 2888621..2888686 - 66 NuclAT_14 - -
- 2888621..2888686 - 66 NuclAT_14 - -
- 2888621..2888686 - 66 NuclAT_16 - -
- 2888621..2888686 - 66 NuclAT_16 - -
- 2888621..2888686 - 66 NuclAT_16 - -
- 2888621..2888686 - 66 NuclAT_16 - -
- 2888621..2888686 - 66 NuclAT_18 - -
- 2888621..2888686 - 66 NuclAT_18 - -
- 2888621..2888686 - 66 NuclAT_18 - -
- 2888621..2888686 - 66 NuclAT_18 - -
- 2888621..2888686 - 66 NuclAT_8 - -
- 2888621..2888686 - 66 NuclAT_8 - -
- 2888621..2888686 - 66 NuclAT_8 - -
- 2888621..2888686 - 66 NuclAT_8 - -
FZN31_RS13765 2888734..2888841 + 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
FZN31_RS13770 2888989..2889843 - 855 WP_000811058.1 3-deoxy-8-phosphooctulonate synthase -
FZN31_RS13775 2889879..2890688 - 810 WP_001257058.1 invasion regulator SirB1 -
FZN31_RS13780 2890692..2891084 - 393 WP_000200378.1 invasion regulator SirB2 -
FZN31_RS13785 2891081..2891914 - 834 WP_000456456.1 peptide chain release factor N(5)-glutamine methyltransferase -
FZN31_RS13790 2891914..2892996 - 1083 WP_000804726.1 peptide chain release factor 1 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4075.89 Da        Isoelectric Point: 11.4779

>T138733 WP_123057329.1 NZ_CP043414:2888199-2888306 [Escherichia coli]
MTLAQFAMIFWHDLAAPFLAGIITAVIVSWWRNRK

Download         Length: 108 bp

>T138733 NZ_CP043414:2888199-2888306 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCGGCACCGTTCCTGGCGGGGATTATTACCGCAGTGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT138733 NZ_CP043414:c2888146-2888085 [Escherichia coli]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References