Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 3956184..3956405 Replicon chromosome
Accession NZ_CP041433
Organism Escherichia coli strain STEC313

Toxin (Protein)


Gene name ldrD Uniprot ID S1PGT3
Locus tag FNE82_RS19275 Protein ID WP_000170954.1
Coordinates 3956184..3956291 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 3956339..3956405 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
FNE82_RS19250 3952028..3953110 + 1083 WP_000804726.1 peptide chain release factor 1 -
FNE82_RS19255 3953110..3953943 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
FNE82_RS19260 3953940..3954332 + 393 WP_000200378.1 invasion regulator SirB2 -
FNE82_RS19265 3954336..3955145 + 810 WP_001257044.1 invasion regulator SirB1 -
FNE82_RS19270 3955181..3956035 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
FNE82_RS19275 3956184..3956291 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 3956339..3956405 + 67 NuclAT_25 - Antitoxin
- 3956339..3956405 + 67 NuclAT_25 - Antitoxin
- 3956339..3956405 + 67 NuclAT_25 - Antitoxin
- 3956339..3956405 + 67 NuclAT_25 - Antitoxin
- 3956339..3956405 + 67 NuclAT_27 - Antitoxin
- 3956339..3956405 + 67 NuclAT_27 - Antitoxin
- 3956339..3956405 + 67 NuclAT_27 - Antitoxin
- 3956339..3956405 + 67 NuclAT_27 - Antitoxin
- 3956339..3956405 + 67 NuclAT_29 - Antitoxin
- 3956339..3956405 + 67 NuclAT_29 - Antitoxin
- 3956339..3956405 + 67 NuclAT_29 - Antitoxin
- 3956339..3956405 + 67 NuclAT_29 - Antitoxin
- 3956339..3956405 + 67 NuclAT_31 - Antitoxin
- 3956339..3956405 + 67 NuclAT_31 - Antitoxin
- 3956339..3956405 + 67 NuclAT_31 - Antitoxin
- 3956339..3956405 + 67 NuclAT_31 - Antitoxin
- 3956339..3956405 + 67 NuclAT_33 - Antitoxin
- 3956339..3956405 + 67 NuclAT_33 - Antitoxin
- 3956339..3956405 + 67 NuclAT_33 - Antitoxin
- 3956339..3956405 + 67 NuclAT_33 - Antitoxin
- 3956339..3956405 + 67 NuclAT_35 - Antitoxin
- 3956339..3956405 + 67 NuclAT_35 - Antitoxin
- 3956339..3956405 + 67 NuclAT_35 - Antitoxin
- 3956339..3956405 + 67 NuclAT_35 - Antitoxin
- 3956341..3956404 + 64 NuclAT_38 - -
- 3956341..3956404 + 64 NuclAT_38 - -
- 3956341..3956404 + 64 NuclAT_38 - -
- 3956341..3956404 + 64 NuclAT_38 - -
- 3956341..3956404 + 64 NuclAT_40 - -
- 3956341..3956404 + 64 NuclAT_40 - -
- 3956341..3956404 + 64 NuclAT_40 - -
- 3956341..3956404 + 64 NuclAT_40 - -
- 3956341..3956404 + 64 NuclAT_42 - -
- 3956341..3956404 + 64 NuclAT_42 - -
- 3956341..3956404 + 64 NuclAT_42 - -
- 3956341..3956404 + 64 NuclAT_42 - -
FNE82_RS19280 3956719..3956826 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3956879..3956940 + 62 NuclAT_37 - -
- 3956879..3956940 + 62 NuclAT_37 - -
- 3956879..3956940 + 62 NuclAT_37 - -
- 3956879..3956940 + 62 NuclAT_37 - -
- 3956879..3956940 + 62 NuclAT_39 - -
- 3956879..3956940 + 62 NuclAT_39 - -
- 3956879..3956940 + 62 NuclAT_39 - -
- 3956879..3956940 + 62 NuclAT_39 - -
- 3956879..3956940 + 62 NuclAT_41 - -
- 3956879..3956940 + 62 NuclAT_41 - -
- 3956879..3956940 + 62 NuclAT_41 - -
- 3956879..3956940 + 62 NuclAT_41 - -
- 3956879..3956941 + 63 NuclAT_26 - -
- 3956879..3956941 + 63 NuclAT_26 - -
- 3956879..3956941 + 63 NuclAT_26 - -
- 3956879..3956941 + 63 NuclAT_26 - -
- 3956879..3956941 + 63 NuclAT_28 - -
- 3956879..3956941 + 63 NuclAT_28 - -
- 3956879..3956941 + 63 NuclAT_28 - -
- 3956879..3956941 + 63 NuclAT_28 - -
- 3956879..3956941 + 63 NuclAT_30 - -
- 3956879..3956941 + 63 NuclAT_30 - -
- 3956879..3956941 + 63 NuclAT_30 - -
- 3956879..3956941 + 63 NuclAT_30 - -
- 3956879..3956941 + 63 NuclAT_32 - -
- 3956879..3956941 + 63 NuclAT_32 - -
- 3956879..3956941 + 63 NuclAT_32 - -
- 3956879..3956941 + 63 NuclAT_32 - -
- 3956879..3956941 + 63 NuclAT_34 - -
- 3956879..3956941 + 63 NuclAT_34 - -
- 3956879..3956941 + 63 NuclAT_34 - -
- 3956879..3956941 + 63 NuclAT_34 - -
- 3956879..3956941 + 63 NuclAT_36 - -
- 3956879..3956941 + 63 NuclAT_36 - -
- 3956879..3956941 + 63 NuclAT_36 - -
- 3956879..3956941 + 63 NuclAT_36 - -
- 3956879..3956942 + 64 NuclAT_14 - -
- 3956879..3956942 + 64 NuclAT_14 - -
- 3956879..3956942 + 64 NuclAT_14 - -
- 3956879..3956942 + 64 NuclAT_14 - -
- 3956879..3956942 + 64 NuclAT_16 - -
- 3956879..3956942 + 64 NuclAT_16 - -
- 3956879..3956942 + 64 NuclAT_16 - -
- 3956879..3956942 + 64 NuclAT_16 - -
- 3956879..3956942 + 64 NuclAT_18 - -
- 3956879..3956942 + 64 NuclAT_18 - -
- 3956879..3956942 + 64 NuclAT_18 - -
- 3956879..3956942 + 64 NuclAT_18 - -
- 3956879..3956942 + 64 NuclAT_20 - -
- 3956879..3956942 + 64 NuclAT_20 - -
- 3956879..3956942 + 64 NuclAT_20 - -
- 3956879..3956942 + 64 NuclAT_20 - -
- 3956879..3956942 + 64 NuclAT_22 - -
- 3956879..3956942 + 64 NuclAT_22 - -
- 3956879..3956942 + 64 NuclAT_22 - -
- 3956879..3956942 + 64 NuclAT_22 - -
- 3956879..3956942 + 64 NuclAT_24 - -
- 3956879..3956942 + 64 NuclAT_24 - -
- 3956879..3956942 + 64 NuclAT_24 - -
- 3956879..3956942 + 64 NuclAT_24 - -
FNE82_RS19285 3957255..3957362 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 3957410..3957477 + 68 NuclAT_13 - -
- 3957410..3957477 + 68 NuclAT_13 - -
- 3957410..3957477 + 68 NuclAT_13 - -
- 3957410..3957477 + 68 NuclAT_13 - -
- 3957410..3957477 + 68 NuclAT_15 - -
- 3957410..3957477 + 68 NuclAT_15 - -
- 3957410..3957477 + 68 NuclAT_15 - -
- 3957410..3957477 + 68 NuclAT_15 - -
- 3957410..3957477 + 68 NuclAT_17 - -
- 3957410..3957477 + 68 NuclAT_17 - -
- 3957410..3957477 + 68 NuclAT_17 - -
- 3957410..3957477 + 68 NuclAT_17 - -
- 3957410..3957477 + 68 NuclAT_19 - -
- 3957410..3957477 + 68 NuclAT_19 - -
- 3957410..3957477 + 68 NuclAT_19 - -
- 3957410..3957477 + 68 NuclAT_19 - -
- 3957410..3957477 + 68 NuclAT_21 - -
- 3957410..3957477 + 68 NuclAT_21 - -
- 3957410..3957477 + 68 NuclAT_21 - -
- 3957410..3957477 + 68 NuclAT_21 - -
- 3957410..3957477 + 68 NuclAT_23 - -
- 3957410..3957477 + 68 NuclAT_23 - -
- 3957410..3957477 + 68 NuclAT_23 - -
- 3957410..3957477 + 68 NuclAT_23 - -
FNE82_RS19290 3957767..3958867 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
FNE82_RS19295 3959137..3959367 + 231 WP_001146442.1 putative cation transport regulator ChaB -
FNE82_RS19300 3959525..3960220 + 696 WP_001355927.1 glutathione-specific gamma-glutamylcyclotransferase -
FNE82_RS19305 3960264..3960617 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.80 Da        Isoelectric Point: 11.4779

>T128534 WP_000170954.1 NZ_CP041433:c3956291-3956184 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T128534 NZ_CP041433:c3956291-3956184 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 67 bp

>AT128534 NZ_CP041433:3956339-3956405 [Escherichia coli]
GTTCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCTC

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A7U9LPE9

Antitoxin

Download structure file

References