Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | I | Classification (family/domain) | hok-sok/- |
Location | 150453..150711 | Replicon | chromosome |
Accession | NZ_CP040805 | ||
Organism | Escherichia fergusonii strain EFCF056 |
Toxin (Protein)
Gene name | hokA | Uniprot ID | - |
Locus tag | D8Z79_RS00705 | Protein ID | WP_001135723.1 |
Coordinates | 150559..150711 (+) | Length | 51 a.a. |
Antitoxin (RNA)
Gene name | sokA | ||
Locus tag | - | ||
Coordinates | 150453..150508 (-) |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
D8Z79_RS00680 | 145668..145967 | + | 300 | WP_024256552.1 | YsaB family lipoprotein | - |
D8Z79_RS00685 | 146063..146974 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
D8Z79_RS00690 | 146984..149053 | + | 2070 | WP_001291786.1 | glycine--tRNA ligase subunit beta | - |
D8Z79_RS00695 | 149122..149502 | + | 381 | WP_139535865.1 | hypothetical protein | - |
D8Z79_RS00700 | 149437..150134 | - | 698 | Protein_137 | IS1 family transposase | - |
- | 150453..150508 | - | 56 | - | - | Antitoxin |
D8Z79_RS00705 | 150559..150711 | + | 153 | WP_001135723.1 | type I toxin-antitoxin system toxin HokA | Toxin |
D8Z79_RS00710 | 150870..151241 | + | 372 | WP_001037803.1 | membrane protein insertion efficiency factor YidD | - |
D8Z79_RS00715 | 151295..151507 | - | 213 | WP_000014594.1 | RNA chaperone/antiterminator CspA | - |
D8Z79_RS00720 | 151789..152079 | - | 291 | WP_000455800.1 | HTH-type transcriptional regulator | - |
D8Z79_RS00725 | 152329..153699 | - | 1371 | WP_125400772.1 | MFS transporter | - |
D8Z79_RS00735 | 154137..154847 | + | 711 | WP_000190514.1 | DUF3053 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5899.14 Da Isoelectric Point: 6.9160
>T126993 WP_001135723.1 NZ_CP040805:150559-150711 [Escherichia fergusonii]
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
MPQKYGLLSLIVICFTLLFFTWMIRDSLCELHIKQESYELAAFLACKLKE
Download Length: 153 bp
>T126993 NZ_CP040805:150559-150711 [Escherichia fergusonii]
ATGCCGCAGAAATACGGATTACTTTCGTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGAGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAGTAA
ATGCCGCAGAAATACGGATTACTTTCGTTAATAGTGATTTGTTTCACGCTTTTATTTTTCACCTGGATGATAAGAGATTC
ACTGTGTGAATTGCATATTAAACAGGAGAGTTATGAGCTGGCGGCGTTTTTAGCCTGCAAATTGAAAGAGTAA
Antitoxin
Download Length: 56 bp
>AT126993 NZ_CP040805:c150508-150453 [Escherichia fergusonii]
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
GTTGAAGCATAGAGGCAGCCTCACTTTGATTTATAGTCAGGTGGGGCTTTTCTCTG
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|