Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1951963..1952188 | Replicon | chromosome |
| Accession | NZ_CP040313 | ||
| Organism | Escherichia coli strain M7638 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | FEL02_RS09055 | Protein ID | WP_000813263.1 |
| Coordinates | 1952033..1952188 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1951963..1952021 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| FEL02_RS09025 | 1947238..1948329 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
| FEL02_RS09030 | 1948336..1949082 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
| FEL02_RS09035 | 1949104..1949874 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| FEL02_RS09040 | 1949890..1950303 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| FEL02_RS09045 | 1950655..1951428 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| - | 1951963..1952021 | - | 59 | - | - | Antitoxin |
| FEL02_RS09055 | 1952033..1952188 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| FEL02_RS09060 | 1952356..1952634 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| FEL02_RS09065 | 1952636..1953685 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| FEL02_RS09070 | 1953698..1954069 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| FEL02_RS09075 | 1954059..1954430 | + | 372 | WP_000090264.1 | antitermination protein | - |
| FEL02_RS09080 | 1954582..1955400 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| FEL02_RS09085 | 1955687..1955883 | + | 197 | Protein_1763 | TrmB family transcriptional regulator | - |
| FEL02_RS09090 | 1956021..1956734 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T125447 WP_000813263.1 NZ_CP040313:1952033-1952188 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T125447 NZ_CP040313:1952033-1952188 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT125447 NZ_CP040313:c1952021-1951963 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|