Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-orzP/Ldr(toxin)
Location 2890971..2891193 Replicon chromosome
Accession NZ_CP038791
Organism Escherichia coli strain PF9285

Toxin (Protein)


Gene name ldrD Uniprot ID D3H2K1
Locus tag E5M00_RS14335 Protein ID WP_000170955.1
Coordinates 2890971..2891078 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name orzP
Locus tag -
Coordinates 2891126..2891193 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E5M00_RS14305 2886219..2886611 + 393 WP_000200374.1 invasion regulator SirB2 -
E5M00_RS14310 2886615..2887424 + 810 WP_001257044.1 invasion regulator SirB1 -
E5M00_RS14315 2887460..2888314 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
E5M00_RS14320 2888463..2888570 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 2888618..2888684 + 67 NuclAT_31 - -
- 2888618..2888684 + 67 NuclAT_31 - -
- 2888618..2888684 + 67 NuclAT_31 - -
- 2888618..2888684 + 67 NuclAT_31 - -
- 2888618..2888684 + 67 NuclAT_33 - -
- 2888618..2888684 + 67 NuclAT_33 - -
- 2888618..2888684 + 67 NuclAT_33 - -
- 2888618..2888684 + 67 NuclAT_33 - -
- 2888618..2888684 + 67 NuclAT_35 - -
- 2888618..2888684 + 67 NuclAT_35 - -
- 2888618..2888684 + 67 NuclAT_35 - -
- 2888618..2888684 + 67 NuclAT_35 - -
- 2888618..2888684 + 67 NuclAT_37 - -
- 2888618..2888684 + 67 NuclAT_37 - -
- 2888618..2888684 + 67 NuclAT_37 - -
- 2888618..2888684 + 67 NuclAT_37 - -
- 2888618..2888684 + 67 NuclAT_39 - -
- 2888618..2888684 + 67 NuclAT_39 - -
- 2888618..2888684 + 67 NuclAT_39 - -
- 2888618..2888684 + 67 NuclAT_39 - -
- 2888618..2888684 + 67 NuclAT_41 - -
- 2888618..2888684 + 67 NuclAT_41 - -
- 2888618..2888684 + 67 NuclAT_41 - -
- 2888618..2888684 + 67 NuclAT_41 - -
- 2888620..2888685 + 66 NuclAT_14 - -
- 2888620..2888685 + 66 NuclAT_14 - -
- 2888620..2888685 + 66 NuclAT_14 - -
- 2888620..2888685 + 66 NuclAT_14 - -
- 2888620..2888685 + 66 NuclAT_17 - -
- 2888620..2888685 + 66 NuclAT_17 - -
- 2888620..2888685 + 66 NuclAT_17 - -
- 2888620..2888685 + 66 NuclAT_17 - -
- 2888620..2888685 + 66 NuclAT_20 - -
- 2888620..2888685 + 66 NuclAT_20 - -
- 2888620..2888685 + 66 NuclAT_20 - -
- 2888620..2888685 + 66 NuclAT_20 - -
- 2888620..2888685 + 66 NuclAT_23 - -
- 2888620..2888685 + 66 NuclAT_23 - -
- 2888620..2888685 + 66 NuclAT_23 - -
- 2888620..2888685 + 66 NuclAT_23 - -
- 2888620..2888685 + 66 NuclAT_26 - -
- 2888620..2888685 + 66 NuclAT_26 - -
- 2888620..2888685 + 66 NuclAT_26 - -
- 2888620..2888685 + 66 NuclAT_26 - -
- 2888620..2888685 + 66 NuclAT_29 - -
- 2888620..2888685 + 66 NuclAT_29 - -
- 2888620..2888685 + 66 NuclAT_29 - -
- 2888620..2888685 + 66 NuclAT_29 - -
E5M00_RS14325 2888998..2889105 - 108 WP_000170963.1 small toxic polypeptide LdrB -
- 2889153..2889209 + 57 NuclAT_15 - -
- 2889153..2889209 + 57 NuclAT_15 - -
- 2889153..2889209 + 57 NuclAT_15 - -
- 2889153..2889209 + 57 NuclAT_15 - -
- 2889153..2889209 + 57 NuclAT_18 - -
- 2889153..2889209 + 57 NuclAT_18 - -
- 2889153..2889209 + 57 NuclAT_18 - -
- 2889153..2889209 + 57 NuclAT_18 - -
- 2889153..2889209 + 57 NuclAT_21 - -
- 2889153..2889209 + 57 NuclAT_21 - -
- 2889153..2889209 + 57 NuclAT_21 - -
- 2889153..2889209 + 57 NuclAT_21 - -
- 2889153..2889209 + 57 NuclAT_24 - -
- 2889153..2889209 + 57 NuclAT_24 - -
- 2889153..2889209 + 57 NuclAT_24 - -
- 2889153..2889209 + 57 NuclAT_24 - -
- 2889153..2889209 + 57 NuclAT_27 - -
- 2889153..2889209 + 57 NuclAT_27 - -
- 2889153..2889209 + 57 NuclAT_27 - -
- 2889153..2889209 + 57 NuclAT_27 - -
- 2889153..2889209 + 57 NuclAT_30 - -
- 2889153..2889209 + 57 NuclAT_30 - -
- 2889153..2889209 + 57 NuclAT_30 - -
- 2889153..2889209 + 57 NuclAT_30 - -
- 2889154..2889209 + 56 NuclAT_32 - -
- 2889154..2889209 + 56 NuclAT_32 - -
- 2889154..2889209 + 56 NuclAT_32 - -
- 2889154..2889209 + 56 NuclAT_32 - -
- 2889154..2889209 + 56 NuclAT_34 - -
- 2889154..2889209 + 56 NuclAT_34 - -
- 2889154..2889209 + 56 NuclAT_34 - -
- 2889154..2889209 + 56 NuclAT_34 - -
- 2889154..2889209 + 56 NuclAT_36 - -
- 2889154..2889209 + 56 NuclAT_36 - -
- 2889154..2889209 + 56 NuclAT_36 - -
- 2889154..2889209 + 56 NuclAT_36 - -
- 2889154..2889209 + 56 NuclAT_38 - -
- 2889154..2889209 + 56 NuclAT_38 - -
- 2889154..2889209 + 56 NuclAT_38 - -
- 2889154..2889209 + 56 NuclAT_38 - -
- 2889154..2889209 + 56 NuclAT_40 - -
- 2889154..2889209 + 56 NuclAT_40 - -
- 2889154..2889209 + 56 NuclAT_40 - -
- 2889154..2889209 + 56 NuclAT_40 - -
- 2889154..2889209 + 56 NuclAT_42 - -
- 2889154..2889209 + 56 NuclAT_42 - -
- 2889154..2889209 + 56 NuclAT_42 - -
- 2889154..2889209 + 56 NuclAT_42 - -
E5M00_RS14330 2889276..2890622 + 1347 WP_000483766.1 IS4-like element IS4 family transposase -
E5M00_RS14335 2890971..2891078 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC Toxin
- 2891126..2891193 + 68 NuclAT_13 - Antitoxin
- 2891126..2891193 + 68 NuclAT_13 - Antitoxin
- 2891126..2891193 + 68 NuclAT_13 - Antitoxin
- 2891126..2891193 + 68 NuclAT_13 - Antitoxin
- 2891126..2891193 + 68 NuclAT_16 - Antitoxin
- 2891126..2891193 + 68 NuclAT_16 - Antitoxin
- 2891126..2891193 + 68 NuclAT_16 - Antitoxin
- 2891126..2891193 + 68 NuclAT_16 - Antitoxin
- 2891126..2891193 + 68 NuclAT_19 - Antitoxin
- 2891126..2891193 + 68 NuclAT_19 - Antitoxin
- 2891126..2891193 + 68 NuclAT_19 - Antitoxin
- 2891126..2891193 + 68 NuclAT_19 - Antitoxin
- 2891126..2891193 + 68 NuclAT_22 - Antitoxin
- 2891126..2891193 + 68 NuclAT_22 - Antitoxin
- 2891126..2891193 + 68 NuclAT_22 - Antitoxin
- 2891126..2891193 + 68 NuclAT_22 - Antitoxin
- 2891126..2891193 + 68 NuclAT_25 - Antitoxin
- 2891126..2891193 + 68 NuclAT_25 - Antitoxin
- 2891126..2891193 + 68 NuclAT_25 - Antitoxin
- 2891126..2891193 + 68 NuclAT_25 - Antitoxin
- 2891126..2891193 + 68 NuclAT_28 - Antitoxin
- 2891126..2891193 + 68 NuclAT_28 - Antitoxin
- 2891126..2891193 + 68 NuclAT_28 - Antitoxin
- 2891126..2891193 + 68 NuclAT_28 - Antitoxin
E5M00_RS14345 2891482..2892582 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
E5M00_RS14350 2892852..2893082 + 231 WP_001146444.1 putative cation transport regulator ChaB -
E5M00_RS14355 2893240..2893935 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
E5M00_RS14360 2893979..2894332 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
E5M00_RS14365 2894517..2895911 + 1395 WP_000086217.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- flank IS/Tn - - 2889294..2890622 1328


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 4013.82 Da        Isoelectric Point: 11.4779

>T123135 WP_000170955.1 NZ_CP038791:c2891078-2890971 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVSWWRNRK

Download         Length: 108 bp

>T123135 NZ_CP038791:c2891078-2890971 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCAGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT123135 NZ_CP038791:2891126-2891193 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCCCGTTTTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A829J2A9

Antitoxin

Download structure file

References