Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 1979527..1979752 | Replicon | chromosome |
| Accession | NZ_CP038376 | ||
| Organism | Escherichia coli O157:H7 strain F1273 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | E3159_RS09295 | Protein ID | WP_000813263.1 |
| Coordinates | 1979597..1979752 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 1979527..1979585 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| E3159_RS09265 | 1974802..1975893 | + | 1092 | WP_128484534.1 | DNA-binding protein | - |
| E3159_RS09270 | 1975900..1976646 | + | 747 | WP_000788751.1 | ATP-binding protein | - |
| E3159_RS09275 | 1976668..1977438 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| E3159_RS09280 | 1977454..1977867 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| E3159_RS09285 | 1978219..1978992 | - | 774 | WP_000160654.1 | alpha/beta hydrolase | - |
| E3159_RS09290 | 1979358..1979495 | - | 138 | WP_000955173.1 | hypothetical protein | - |
| - | 1979527..1979585 | - | 59 | - | - | Antitoxin |
| E3159_RS09295 | 1979597..1979752 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| E3159_RS09300 | 1979920..1980198 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| E3159_RS09305 | 1980200..1981249 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| E3159_RS09310 | 1981262..1981633 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| E3159_RS09315 | 1981623..1981994 | + | 372 | WP_000090264.1 | antitermination protein | - |
| E3159_RS09320 | 1982146..1982964 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| E3159_RS09325 | 1983251..1983447 | + | 197 | Protein_1806 | TrmB family transcriptional regulator | - |
| E3159_RS09330 | 1983585..1984298 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T122158 WP_000813263.1 NZ_CP038376:1979597-1979752 [Escherichia coli O157:H7]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T122158 NZ_CP038376:1979597-1979752 [Escherichia coli O157:H7]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT122158 NZ_CP038376:c1979585-1979527 [Escherichia coli O157:H7]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|