Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 2747336..2747550 Replicon chromosome
Accession NZ_CP038292
Organism Escherichia coli O157:H7 strain TB21-1

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag E4U65_RS13990 Protein ID WP_000170963.1
Coordinates 2747336..2747443 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 2747491..2747550 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E4U65_RS13960 2742645..2743727 + 1083 WP_000804726.1 peptide chain release factor 1 -
E4U65_RS13965 2743727..2744560 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
E4U65_RS13970 2744557..2744949 + 393 WP_000200379.1 invasion regulator SirB2 -
E4U65_RS13975 2744953..2745762 + 810 WP_001257044.1 invasion regulator SirB1 -
E4U65_RS13980 2745798..2746652 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
E4U65_RS13985 2746800..2746907 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2746960..2747021 + 62 NuclAT_24 - -
- 2746960..2747021 + 62 NuclAT_24 - -
- 2746960..2747021 + 62 NuclAT_24 - -
- 2746960..2747021 + 62 NuclAT_24 - -
- 2746960..2747021 + 62 NuclAT_26 - -
- 2746960..2747021 + 62 NuclAT_26 - -
- 2746960..2747021 + 62 NuclAT_26 - -
- 2746960..2747021 + 62 NuclAT_26 - -
- 2746960..2747021 + 62 NuclAT_28 - -
- 2746960..2747021 + 62 NuclAT_28 - -
- 2746960..2747021 + 62 NuclAT_28 - -
- 2746960..2747021 + 62 NuclAT_28 - -
- 2746960..2747021 + 62 NuclAT_30 - -
- 2746960..2747021 + 62 NuclAT_30 - -
- 2746960..2747021 + 62 NuclAT_30 - -
- 2746960..2747021 + 62 NuclAT_30 - -
- 2746960..2747021 + 62 NuclAT_32 - -
- 2746960..2747021 + 62 NuclAT_32 - -
- 2746960..2747021 + 62 NuclAT_32 - -
- 2746960..2747021 + 62 NuclAT_32 - -
- 2746960..2747022 + 63 NuclAT_17 - -
- 2746960..2747022 + 63 NuclAT_17 - -
- 2746960..2747022 + 63 NuclAT_17 - -
- 2746960..2747022 + 63 NuclAT_17 - -
- 2746960..2747022 + 63 NuclAT_18 - -
- 2746960..2747022 + 63 NuclAT_18 - -
- 2746960..2747022 + 63 NuclAT_18 - -
- 2746960..2747022 + 63 NuclAT_18 - -
- 2746960..2747022 + 63 NuclAT_19 - -
- 2746960..2747022 + 63 NuclAT_19 - -
- 2746960..2747022 + 63 NuclAT_19 - -
- 2746960..2747022 + 63 NuclAT_19 - -
- 2746960..2747022 + 63 NuclAT_20 - -
- 2746960..2747022 + 63 NuclAT_20 - -
- 2746960..2747022 + 63 NuclAT_20 - -
- 2746960..2747022 + 63 NuclAT_20 - -
- 2746960..2747022 + 63 NuclAT_22 - -
- 2746960..2747022 + 63 NuclAT_22 - -
- 2746960..2747022 + 63 NuclAT_22 - -
- 2746960..2747022 + 63 NuclAT_22 - -
- 2746960..2747022 + 63 NuclAT_23 - -
- 2746960..2747022 + 63 NuclAT_23 - -
- 2746960..2747022 + 63 NuclAT_23 - -
- 2746960..2747022 + 63 NuclAT_23 - -
E4U65_RS13990 2747336..2747443 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 2747491..2747550 + 60 NuclAT_25 - Antitoxin
- 2747491..2747550 + 60 NuclAT_25 - Antitoxin
- 2747491..2747550 + 60 NuclAT_25 - Antitoxin
- 2747491..2747550 + 60 NuclAT_25 - Antitoxin
- 2747491..2747550 + 60 NuclAT_27 - Antitoxin
- 2747491..2747550 + 60 NuclAT_27 - Antitoxin
- 2747491..2747550 + 60 NuclAT_27 - Antitoxin
- 2747491..2747550 + 60 NuclAT_27 - Antitoxin
- 2747491..2747550 + 60 NuclAT_29 - Antitoxin
- 2747491..2747550 + 60 NuclAT_29 - Antitoxin
- 2747491..2747550 + 60 NuclAT_29 - Antitoxin
- 2747491..2747550 + 60 NuclAT_29 - Antitoxin
- 2747491..2747550 + 60 NuclAT_31 - Antitoxin
- 2747491..2747550 + 60 NuclAT_31 - Antitoxin
- 2747491..2747550 + 60 NuclAT_31 - Antitoxin
- 2747491..2747550 + 60 NuclAT_31 - Antitoxin
- 2747491..2747550 + 60 NuclAT_33 - Antitoxin
- 2747491..2747550 + 60 NuclAT_33 - Antitoxin
- 2747491..2747550 + 60 NuclAT_33 - Antitoxin
- 2747491..2747550 + 60 NuclAT_33 - Antitoxin
E4U65_RS13995 2747842..2748942 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
E4U65_RS14000 2749212..2749442 + 231 WP_001146444.1 putative cation transport regulator ChaB -
E4U65_RS14005 2749603..2750298 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
E4U65_RS14010 2750342..2750695 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -
E4U65_RS14015 2750881..2752275 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T121131 WP_000170963.1 NZ_CP038292:c2747443-2747336 [Escherichia coli O157:H7]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T121131 NZ_CP038292:c2747443-2747336 [Escherichia coli O157:H7]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT121131 NZ_CP038292:2747491-2747550 [Escherichia coli O157:H7]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References