Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 2882829..2883049 | Replicon | chromosome |
| Accession | NZ_CP037941 | ||
| Organism | Escherichia coli strain CFSAN027350 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1PGT3 |
| Locus tag | EKI55_RS14505 | Protein ID | WP_000170954.1 |
| Coordinates | 2882829..2882936 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 2882986..2883049 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| EKI55_RS14480 | 2878673..2879755 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| EKI55_RS14485 | 2879755..2880588 | + | 834 | WP_000456467.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| EKI55_RS14490 | 2880585..2880977 | + | 393 | WP_000200378.1 | invasion regulator SirB2 | - |
| EKI55_RS14495 | 2880981..2881790 | + | 810 | WP_001257045.1 | invasion regulator SirB1 | - |
| EKI55_RS14500 | 2881826..2882680 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| EKI55_RS14505 | 2882829..2882936 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2882986..2883049 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_31 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_34 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_37 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_40 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_43 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_43 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_43 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_43 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_46 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_46 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_46 | - | Antitoxin |
| - | 2882986..2883049 | + | 64 | NuclAT_46 | - | Antitoxin |
| EKI55_RS14510 | 2883364..2883471 | - | 108 | WP_000170959.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2883524..2883585 | + | 62 | NuclAT_30 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_30 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_30 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_30 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_33 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_33 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_33 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_33 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_36 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_36 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_36 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_36 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_39 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_39 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_39 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_39 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_42 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_42 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_42 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_42 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_45 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_45 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_45 | - | - |
| - | 2883524..2883585 | + | 62 | NuclAT_45 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_16 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_16 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_16 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_16 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_18 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_18 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_18 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_18 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_20 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_20 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_20 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_20 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_22 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_22 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_22 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_22 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_24 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_24 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_24 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_24 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_26 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_26 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_26 | - | - |
| - | 2883524..2883587 | + | 64 | NuclAT_26 | - | - |
| EKI55_RS14515 | 2883900..2884007 | - | 108 | WP_000170955.1 | small toxic polypeptide LdrA/LdrC | - |
| - | 2884055..2884120 | + | 66 | NuclAT_29 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_29 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_29 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_29 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_32 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_32 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_32 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_32 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_35 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_35 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_35 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_35 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_38 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_38 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_38 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_38 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_41 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_41 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_41 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_41 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_44 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_44 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_44 | - | - |
| - | 2884055..2884120 | + | 66 | NuclAT_44 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_15 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_15 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_15 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_15 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_17 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_17 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_17 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_17 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_19 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_19 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_19 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_19 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_21 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_21 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_21 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_21 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_23 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_23 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_23 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_23 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_25 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_25 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_25 | - | - |
| - | 2884055..2884122 | + | 68 | NuclAT_25 | - | - |
| EKI55_RS14520 | 2884412..2885512 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| EKI55_RS14525 | 2885782..2886012 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| EKI55_RS14530 | 2886170..2886865 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| EKI55_RS14535 | 2886909..2887262 | - | 354 | WP_001169669.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.80 Da Isoelectric Point: 11.4779
>T120429 WP_000170954.1 NZ_CP037941:c2882936-2882829 [Escherichia coli]
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAQFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T120429 NZ_CP037941:c2882936-2882829 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGCAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 64 bp
>AT120429 NZ_CP037941:2882986-2883049 [Escherichia coli]
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TCTGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|