Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 1264821..1265043 Replicon chromosome
Accession NZ_CP037857
Organism Escherichia coli BW25113 strain AM187

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag E1A98_RS06210 Protein ID WP_000170963.1
Coordinates 1264821..1264928 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 1264976..1265043 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
E1A98_RS06180 1260130..1261212 + 1083 WP_000804726.1 peptide chain release factor 1 -
E1A98_RS06185 1261212..1262045 + 834 WP_000456467.1 peptide chain release factor N(5)-glutamine methyltransferase -
E1A98_RS06190 1262042..1262434 + 393 WP_000200374.1 invasion regulator SirB2 -
E1A98_RS06195 1262438..1263247 + 810 WP_001257044.1 invasion regulator SirB1 -
E1A98_RS06200 1263283..1264137 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
E1A98_RS06205 1264286..1264393 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1264441..1264507 + 67 NuclAT_34 - -
- 1264441..1264507 + 67 NuclAT_34 - -
- 1264441..1264507 + 67 NuclAT_34 - -
- 1264441..1264507 + 67 NuclAT_34 - -
- 1264441..1264507 + 67 NuclAT_36 - -
- 1264441..1264507 + 67 NuclAT_36 - -
- 1264441..1264507 + 67 NuclAT_36 - -
- 1264441..1264507 + 67 NuclAT_36 - -
- 1264441..1264507 + 67 NuclAT_38 - -
- 1264441..1264507 + 67 NuclAT_38 - -
- 1264441..1264507 + 67 NuclAT_38 - -
- 1264441..1264507 + 67 NuclAT_38 - -
- 1264441..1264507 + 67 NuclAT_40 - -
- 1264441..1264507 + 67 NuclAT_40 - -
- 1264441..1264507 + 67 NuclAT_40 - -
- 1264441..1264507 + 67 NuclAT_40 - -
- 1264441..1264507 + 67 NuclAT_42 - -
- 1264441..1264507 + 67 NuclAT_42 - -
- 1264441..1264507 + 67 NuclAT_42 - -
- 1264441..1264507 + 67 NuclAT_42 - -
- 1264441..1264507 + 67 NuclAT_44 - -
- 1264441..1264507 + 67 NuclAT_44 - -
- 1264441..1264507 + 67 NuclAT_44 - -
- 1264441..1264507 + 67 NuclAT_44 - -
- 1264443..1264508 + 66 NuclAT_18 - -
- 1264443..1264508 + 66 NuclAT_18 - -
- 1264443..1264508 + 66 NuclAT_18 - -
- 1264443..1264508 + 66 NuclAT_18 - -
- 1264443..1264508 + 66 NuclAT_21 - -
- 1264443..1264508 + 66 NuclAT_21 - -
- 1264443..1264508 + 66 NuclAT_21 - -
- 1264443..1264508 + 66 NuclAT_21 - -
- 1264443..1264508 + 66 NuclAT_24 - -
- 1264443..1264508 + 66 NuclAT_24 - -
- 1264443..1264508 + 66 NuclAT_24 - -
- 1264443..1264508 + 66 NuclAT_24 - -
- 1264443..1264508 + 66 NuclAT_27 - -
- 1264443..1264508 + 66 NuclAT_27 - -
- 1264443..1264508 + 66 NuclAT_27 - -
- 1264443..1264508 + 66 NuclAT_27 - -
- 1264443..1264508 + 66 NuclAT_30 - -
- 1264443..1264508 + 66 NuclAT_30 - -
- 1264443..1264508 + 66 NuclAT_30 - -
- 1264443..1264508 + 66 NuclAT_30 - -
- 1264443..1264508 + 66 NuclAT_33 - -
- 1264443..1264508 + 66 NuclAT_33 - -
- 1264443..1264508 + 66 NuclAT_33 - -
- 1264443..1264508 + 66 NuclAT_33 - -
E1A98_RS06210 1264821..1264928 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 1264976..1265043 + 68 NuclAT_17 - Antitoxin
- 1264976..1265043 + 68 NuclAT_17 - Antitoxin
- 1264976..1265043 + 68 NuclAT_17 - Antitoxin
- 1264976..1265043 + 68 NuclAT_17 - Antitoxin
- 1264976..1265043 + 68 NuclAT_20 - Antitoxin
- 1264976..1265043 + 68 NuclAT_20 - Antitoxin
- 1264976..1265043 + 68 NuclAT_20 - Antitoxin
- 1264976..1265043 + 68 NuclAT_20 - Antitoxin
- 1264976..1265043 + 68 NuclAT_23 - Antitoxin
- 1264976..1265043 + 68 NuclAT_23 - Antitoxin
- 1264976..1265043 + 68 NuclAT_23 - Antitoxin
- 1264976..1265043 + 68 NuclAT_23 - Antitoxin
- 1264976..1265043 + 68 NuclAT_26 - Antitoxin
- 1264976..1265043 + 68 NuclAT_26 - Antitoxin
- 1264976..1265043 + 68 NuclAT_26 - Antitoxin
- 1264976..1265043 + 68 NuclAT_26 - Antitoxin
- 1264976..1265043 + 68 NuclAT_29 - Antitoxin
- 1264976..1265043 + 68 NuclAT_29 - Antitoxin
- 1264976..1265043 + 68 NuclAT_29 - Antitoxin
- 1264976..1265043 + 68 NuclAT_29 - Antitoxin
- 1264976..1265043 + 68 NuclAT_32 - Antitoxin
- 1264976..1265043 + 68 NuclAT_32 - Antitoxin
- 1264976..1265043 + 68 NuclAT_32 - Antitoxin
- 1264976..1265043 + 68 NuclAT_32 - Antitoxin
- 1264977..1265042 + 66 NuclAT_35 - -
- 1264977..1265042 + 66 NuclAT_35 - -
- 1264977..1265042 + 66 NuclAT_35 - -
- 1264977..1265042 + 66 NuclAT_35 - -
- 1264977..1265042 + 66 NuclAT_37 - -
- 1264977..1265042 + 66 NuclAT_37 - -
- 1264977..1265042 + 66 NuclAT_37 - -
- 1264977..1265042 + 66 NuclAT_37 - -
- 1264977..1265042 + 66 NuclAT_39 - -
- 1264977..1265042 + 66 NuclAT_39 - -
- 1264977..1265042 + 66 NuclAT_39 - -
- 1264977..1265042 + 66 NuclAT_39 - -
- 1264977..1265042 + 66 NuclAT_41 - -
- 1264977..1265042 + 66 NuclAT_41 - -
- 1264977..1265042 + 66 NuclAT_41 - -
- 1264977..1265042 + 66 NuclAT_41 - -
- 1264977..1265042 + 66 NuclAT_43 - -
- 1264977..1265042 + 66 NuclAT_43 - -
- 1264977..1265042 + 66 NuclAT_43 - -
- 1264977..1265042 + 66 NuclAT_43 - -
- 1264977..1265042 + 66 NuclAT_45 - -
- 1264977..1265042 + 66 NuclAT_45 - -
- 1264977..1265042 + 66 NuclAT_45 - -
- 1264977..1265042 + 66 NuclAT_45 - -
E1A98_RS06215 1265356..1265463 - 108 WP_000170955.1 small toxic polypeptide LdrA/LdrC -
- 1265511..1265578 + 68 NuclAT_16 - -
- 1265511..1265578 + 68 NuclAT_16 - -
- 1265511..1265578 + 68 NuclAT_16 - -
- 1265511..1265578 + 68 NuclAT_16 - -
- 1265511..1265578 + 68 NuclAT_19 - -
- 1265511..1265578 + 68 NuclAT_19 - -
- 1265511..1265578 + 68 NuclAT_19 - -
- 1265511..1265578 + 68 NuclAT_19 - -
- 1265511..1265578 + 68 NuclAT_22 - -
- 1265511..1265578 + 68 NuclAT_22 - -
- 1265511..1265578 + 68 NuclAT_22 - -
- 1265511..1265578 + 68 NuclAT_22 - -
- 1265511..1265578 + 68 NuclAT_25 - -
- 1265511..1265578 + 68 NuclAT_25 - -
- 1265511..1265578 + 68 NuclAT_25 - -
- 1265511..1265578 + 68 NuclAT_25 - -
- 1265511..1265578 + 68 NuclAT_28 - -
- 1265511..1265578 + 68 NuclAT_28 - -
- 1265511..1265578 + 68 NuclAT_28 - -
- 1265511..1265578 + 68 NuclAT_28 - -
- 1265511..1265578 + 68 NuclAT_31 - -
- 1265511..1265578 + 68 NuclAT_31 - -
- 1265511..1265578 + 68 NuclAT_31 - -
- 1265511..1265578 + 68 NuclAT_31 - -
E1A98_RS06225 1265867..1266967 - 1101 WP_000063607.1 sodium-potassium/proton antiporter ChaA -
E1A98_RS06230 1267237..1267467 + 231 WP_001146444.1 putative cation transport regulator ChaB -
E1A98_RS06235 1267625..1268320 + 696 WP_001336325.1 glutathione-specific gamma-glutamylcyclotransferase -
E1A98_RS06240 1268364..1268717 - 354 WP_001169669.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T120201 WP_000170963.1 NZ_CP037857:c1264928-1264821 [Escherichia coli BW25113]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T120201 NZ_CP037857:c1264928-1264821 [Escherichia coli BW25113]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 68 bp

>AT120201 NZ_CP037857:1264976-1265043 [Escherichia coli BW25113]
GTCTGGTTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References