Detailed information of TA system TA119010

Bioinformatically predicted

Overview

TA module

• Type: I
• Classification (family/domain): hok-sok/-
• Location: 15139..15403
• Replicon: plasmid pWS0115A_186
• Accession: NZ_CP035883
• Organism: Escherichia coli strain WS0115A

Toxin (Protein)

• Gene name: pndA
• Uniprot ID: E6BRV3
• Locus tag: EW996_RS23500
• Protein ID: WP_001303307.1
• Coordinates: 15139..15291 (-)
• Length: 51 a.a.

Antitoxin (RNA)

Gene name	pndB
Locus tag	-
Coordinates	15341..15403 (+)

Genomic Context

Locus tag	Coordinates	Strand	Size (bp)	Protein ID	Product	Description
EW996_RS23465 (10507)	10507..10842	+	336	WP_074502153.1	colicin E1 family microcin immunity protein	-
EW996_RS23470 (10864)	10864..10989	-	126	Protein_16	colicin-like pore-forming protein	-
EW996_RS23475 (10987)	10987..12312	+	1326	Protein_17	DotA/TraY family protein	-
EW996_RS23480 (12382)	12382..13044	+	663	WP_074502148.1	plasmid IncI1-type surface exclusion protein ExcA	-
EW996_RS23485 (13116)	13116..13325	-	210	WP_074502145.1	HEAT repeat domain-containing protein	-
EW996_RS23490 (13715)	13715..13891	+	177	WP_074502143.1	hypothetical protein	-
- (14378)	14378..14429	+	52	NuclAT_3	-	-
- (14378)	14378..14429	+	52	NuclAT_3	-	-
- (14378)	14378..14429	+	52	NuclAT_3	-	-
- (14378)	14378..14429	+	52	NuclAT_3	-	-
EW996_RS23495 (14816)	14816..15067	+	252	WP_001291965.1	hypothetical protein	-
EW996_RS23500 (15139)	15139..15291	-	153	WP_001303307.1	Hok/Gef family protein	Toxin
- (15341)	15341..15403	+	63	NuclAT_1	-	Antitoxin
- (15341)	15341..15403	+	63	NuclAT_1	-	Antitoxin
- (15341)	15341..15403	+	63	NuclAT_1	-	Antitoxin
- (15341)	15341..15403	+	63	NuclAT_1	-	Antitoxin
- (15644)	15644..15699	+	56	NuclAT_2	-	-
- (15644)	15644..15699	+	56	NuclAT_2	-	-
- (15644)	15644..15699	+	56	NuclAT_2	-	-
- (15644)	15644..15699	+	56	NuclAT_2	-	-
EW996_RS23505 (15893)	15893..16846	+	954	WP_021555372.1	hypothetical protein	-
EW996_RS23510 (17064)	17064..17513	+	450	Protein_24	IncI1-type conjugal transfer protein TrbA	-
EW996_RS23515 (17698)	17698..17928	+	231	WP_074502137.1	type II toxin-antitoxin system VapB family antitoxin	-
EW996_RS23520 (17925)	17925..18341	+	417	WP_077899839.1	type II toxin-antitoxin system VapC family toxin	-
EW996_RS23525 (18503)	18503..20149	-	1647	WP_249531163.1	AAA family ATPase	-

Associated MGEs

MGE detail	Similar MGEs	Relative position	MGE Type	Cargo ARG	Virulence gene	Coordinates	Length (bp)
	-	inside	Conjugative plasmid	-	csdD / csdC / csdA / csdB / estIa / etpA / etpB / eltB / eltA	1..186206	186206

Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.

Domains

Predicted by InterproScan

Toxin

• Hok/gef cell toxic protein (7-46)

Sequences

Toxin

Protein

• Length: 51 a.a.
• Molecular weight: 5817.21 Da
• Isoelectric Point: 8.7948

>T119010 WP_001303307.1 NZ_CP035883:c15291-15139 [Escherichia coli]
MPQRTFLMMLIVICVTILCFVWMVRDSLCVLRLQQGNTVLVATLAYEVKR

Nucleotide

• Length: 153 bp

>T119010 NZ_CP035883:c15291-15139 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCATCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGTACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA

Antitoxin

Nucleotide

• Length: 63 bp

>AT119010 NZ_CP035883:15341-15403 [Escherichia coli]
TCGAAGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT

Structures

Toxin

• AlphaFold DB: A0A634Q5L1

Antitoxin