Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-rdlD/Ldr(toxin)
Location 5377798..5378012 Replicon chromosome
Accession NZ_CP034797
Organism Escherichia coli strain 08-3918

Toxin (Protein)


Gene name ldrD Uniprot ID J7R083
Locus tag AYP37_RS27755 Protein ID WP_000170963.1
Coordinates 5377798..5377905 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name rdlD
Locus tag -
Coordinates 5377953..5378012 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
AYP37_RS27725 5373107..5374189 + 1083 WP_000804726.1 peptide chain release factor 1 -
AYP37_RS27730 5374189..5375022 + 834 WP_000456466.1 peptide chain release factor N(5)-glutamine methyltransferase -
AYP37_RS27735 5375019..5375411 + 393 WP_000200379.1 invasion regulator SirB2 -
AYP37_RS27740 5375415..5376224 + 810 WP_001257044.1 invasion regulator SirB1 -
AYP37_RS27745 5376260..5377114 + 855 WP_000811067.1 3-deoxy-8-phosphooctulonate synthase -
AYP37_RS27750 5377262..5377369 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 5377422..5377483 + 62 NuclAT_24 - -
- 5377422..5377483 + 62 NuclAT_24 - -
- 5377422..5377483 + 62 NuclAT_24 - -
- 5377422..5377483 + 62 NuclAT_24 - -
- 5377422..5377483 + 62 NuclAT_26 - -
- 5377422..5377483 + 62 NuclAT_26 - -
- 5377422..5377483 + 62 NuclAT_26 - -
- 5377422..5377483 + 62 NuclAT_26 - -
- 5377422..5377483 + 62 NuclAT_28 - -
- 5377422..5377483 + 62 NuclAT_28 - -
- 5377422..5377483 + 62 NuclAT_28 - -
- 5377422..5377483 + 62 NuclAT_28 - -
- 5377422..5377483 + 62 NuclAT_30 - -
- 5377422..5377483 + 62 NuclAT_30 - -
- 5377422..5377483 + 62 NuclAT_30 - -
- 5377422..5377483 + 62 NuclAT_30 - -
- 5377422..5377483 + 62 NuclAT_32 - -
- 5377422..5377483 + 62 NuclAT_32 - -
- 5377422..5377483 + 62 NuclAT_32 - -
- 5377422..5377483 + 62 NuclAT_32 - -
- 5377422..5377484 + 63 NuclAT_17 - -
- 5377422..5377484 + 63 NuclAT_17 - -
- 5377422..5377484 + 63 NuclAT_17 - -
- 5377422..5377484 + 63 NuclAT_17 - -
- 5377422..5377484 + 63 NuclAT_18 - -
- 5377422..5377484 + 63 NuclAT_18 - -
- 5377422..5377484 + 63 NuclAT_18 - -
- 5377422..5377484 + 63 NuclAT_18 - -
- 5377422..5377484 + 63 NuclAT_19 - -
- 5377422..5377484 + 63 NuclAT_19 - -
- 5377422..5377484 + 63 NuclAT_19 - -
- 5377422..5377484 + 63 NuclAT_19 - -
- 5377422..5377484 + 63 NuclAT_20 - -
- 5377422..5377484 + 63 NuclAT_20 - -
- 5377422..5377484 + 63 NuclAT_20 - -
- 5377422..5377484 + 63 NuclAT_20 - -
- 5377422..5377484 + 63 NuclAT_22 - -
- 5377422..5377484 + 63 NuclAT_22 - -
- 5377422..5377484 + 63 NuclAT_22 - -
- 5377422..5377484 + 63 NuclAT_22 - -
- 5377422..5377484 + 63 NuclAT_23 - -
- 5377422..5377484 + 63 NuclAT_23 - -
- 5377422..5377484 + 63 NuclAT_23 - -
- 5377422..5377484 + 63 NuclAT_23 - -
AYP37_RS27755 5377798..5377905 - 108 WP_000170963.1 small toxic polypeptide LdrB Toxin
- 5377953..5378012 + 60 NuclAT_25 - Antitoxin
- 5377953..5378012 + 60 NuclAT_25 - Antitoxin
- 5377953..5378012 + 60 NuclAT_25 - Antitoxin
- 5377953..5378012 + 60 NuclAT_25 - Antitoxin
- 5377953..5378012 + 60 NuclAT_27 - Antitoxin
- 5377953..5378012 + 60 NuclAT_27 - Antitoxin
- 5377953..5378012 + 60 NuclAT_27 - Antitoxin
- 5377953..5378012 + 60 NuclAT_27 - Antitoxin
- 5377953..5378012 + 60 NuclAT_29 - Antitoxin
- 5377953..5378012 + 60 NuclAT_29 - Antitoxin
- 5377953..5378012 + 60 NuclAT_29 - Antitoxin
- 5377953..5378012 + 60 NuclAT_29 - Antitoxin
- 5377953..5378012 + 60 NuclAT_31 - Antitoxin
- 5377953..5378012 + 60 NuclAT_31 - Antitoxin
- 5377953..5378012 + 60 NuclAT_31 - Antitoxin
- 5377953..5378012 + 60 NuclAT_31 - Antitoxin
- 5377953..5378012 + 60 NuclAT_33 - Antitoxin
- 5377953..5378012 + 60 NuclAT_33 - Antitoxin
- 5377953..5378012 + 60 NuclAT_33 - Antitoxin
- 5377953..5378012 + 60 NuclAT_33 - Antitoxin
AYP37_RS27760 5378304..5379404 - 1101 WP_001301956.1 sodium-potassium/proton antiporter ChaA -
AYP37_RS27765 5379674..5379904 + 231 WP_001146444.1 putative cation transport regulator ChaB -
AYP37_RS27770 5380065..5380760 + 696 WP_001301489.1 glutathione-specific gamma-glutamylcyclotransferase -
AYP37_RS27775 5380804..5381157 - 354 WP_001169661.1 DsrE/F sulfur relay family protein YchN -
AYP37_RS27780 5381343..5382737 + 1395 WP_000086192.1 inverse autotransporter invasin YchO -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3971.74 Da        Isoelectric Point: 11.4779

>T116680 WP_000170963.1 NZ_CP034797:c5377905-5377798 [Escherichia coli]
MTLAQFAMTFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T116680 NZ_CP034797:c5377905-5377798 [Escherichia coli]
ATGACGCTCGCGCAGTTTGCCATGACTTTCTGGCACGACCTGGCGGCACCGATCCTGGCGGGAATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 60 bp

>AT116680 NZ_CP034797:5377953-5378012 [Escherichia coli]
GTCTGGTTTCAAGATTAGCCCTGTTGTCAGGTTTTACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Download structure file

References