Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 4904063..4904288 | Replicon | chromosome |
| Accession | NZ_CP034797 | ||
| Organism | Escherichia coli strain 08-3918 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | - |
| Locus tag | AYP37_RS25005 | Protein ID | WP_000813263.1 |
| Coordinates | 4904133..4904288 (+) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 4904063..4904121 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYP37_RS24970 | 4899338..4900429 | + | 1092 | WP_001205823.1 | hypothetical protein | - |
| AYP37_RS24975 | 4900436..4901182 | + | 747 | WP_000788745.1 | ATP-binding protein | - |
| AYP37_RS24980 | 4901204..4901974 | + | 771 | WP_000450992.1 | DUF1627 domain-containing protein | - |
| AYP37_RS24985 | 4901990..4902403 | + | 414 | WP_001151233.1 | DUF977 family protein | - |
| AYP37_RS24990 | 4902755..4903528 | - | 774 | WP_000160650.1 | alpha/beta hydrolase | - |
| - | 4904063..4904121 | - | 59 | - | - | Antitoxin |
| AYP37_RS25005 | 4904133..4904288 | + | 156 | WP_000813263.1 | type I toxin-antitoxin system toxin HokD | Toxin |
| AYP37_RS25010 | 4904456..4904734 | + | 279 | WP_001341388.1 | hypothetical protein | - |
| AYP37_RS25015 | 4904736..4905785 | + | 1050 | WP_001265172.1 | DUF968 domain-containing protein | - |
| AYP37_RS25020 | 4905798..4906169 | + | 372 | WP_001217436.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYP37_RS25025 | 4906159..4906530 | + | 372 | WP_000090264.1 | antitermination protein | - |
| AYP37_RS25030 | 4906682..4907500 | + | 819 | WP_000265265.1 | CPBP family intramembrane metalloprotease | - |
| AYP37_RS25035 | 4907787..4907983 | + | 197 | Protein_4658 | TrmB family transcriptional regulator | - |
| AYP37_RS25040 | 4908121..4908834 | + | 714 | WP_000261909.1 | helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5722.86 Da Isoelectric Point: 6.1531
>T116677 WP_000813263.1 NZ_CP034797:4904133-4904288 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRVRTGQTEVAVFTAYEPEE
Download Length: 156 bp
>T116677 NZ_CP034797:4904133-4904288 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTACGAGTCCGAACCGGCCAGACGGAGGTCGCTGTCTTCACAGCTTACGAACCTGAGGAGTAA
Antitoxin
Download Length: 59 bp
>AT116677 NZ_CP034797:c4904121-4904063 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTAGATTTGCCGTTCATAGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|