Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 376473..376698 | Replicon | chromosome |
| Accession | NZ_CP034797 | ||
| Organism | Escherichia coli strain 08-3918 | ||
Toxin (Protein)
| Gene name | hokW | Uniprot ID | A0A1Q4PF16 |
| Locus tag | AYP37_RS02480 | Protein ID | WP_000813258.1 |
| Coordinates | 376473..376628 (-) | Length | 52 a.a. |
Antitoxin (RNA)
| Gene name | sokW | ||
| Locus tag | - | ||
| Coordinates | 376640..376698 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| AYP37_RS02430 | 371476..371907 | - | 432 | WP_001302123.1 | tellurite resistance protein | - |
| AYP37_RS02445 | 372358..373071 | - | 714 | WP_000301797.1 | helix-turn-helix domain-containing protein | - |
| AYP37_RS02450 | 373207..373404 | - | 198 | WP_000917763.1 | hypothetical protein | - |
| AYP37_RS02455 | 373629..374183 | - | 555 | WP_000640035.1 | DUF1133 family protein | - |
| AYP37_RS02460 | 374246..374551 | - | 306 | WP_001217444.1 | RusA family crossover junction endodeoxyribonuclease | - |
| AYP37_RS02465 | 374564..375613 | - | 1050 | WP_001265229.1 | DUF968 domain-containing protein | - |
| AYP37_RS02470 | 375615..375887 | - | 273 | WP_000191871.1 | hypothetical protein | - |
| AYP37_RS02475 | 376009..376353 | - | 345 | WP_000756596.1 | YgiW/YdeI family stress tolerance OB fold protein | - |
| AYP37_RS02480 | 376473..376628 | - | 156 | WP_000813258.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| - | 376640..376698 | + | 59 | - | - | Antitoxin |
| AYP37_RS02485 | 376919..377476 | - | 558 | WP_000104474.1 | DUF551 domain-containing protein | - |
| AYP37_RS02490 | 377478..377696 | - | 219 | WP_000683609.1 | DUF4014 family protein | - |
| AYP37_RS02495 | 377824..378135 | - | 312 | WP_001289673.1 | hypothetical protein | - |
| AYP37_RS02500 | 378128..378355 | - | 228 | WP_000699809.1 | hypothetical protein | - |
| AYP37_RS02505 | 378352..378633 | - | 282 | WP_000603384.1 | DNA-binding protein | - |
| AYP37_RS02510 | 378666..379382 | - | 717 | WP_000450627.1 | DUF1627 domain-containing protein | - |
| AYP37_RS02515 | 379416..379877 | - | 462 | WP_000139447.1 | replication protein | - |
| AYP37_RS02520 | 379870..380925 | - | 1056 | WP_001356791.1 | hypothetical protein | - |
| AYP37_RS02525 | 380994..381419 | - | 426 | WP_000693878.1 | Rha family transcriptional regulator | - |
| AYP37_RS02530 | 381403..381646 | - | 244 | Protein_376 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | nleG7' | 339025..437187 | 98162 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 52 a.a. Molecular weight: 5767.95 Da Isoelectric Point: 7.7942
>T116644 WP_000813258.1 NZ_CP034797:c376628-376473 [Escherichia coli]
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
MKQQKAMLIALIVICLTVIVTALVTRKDLCEVRIRTGQTEVAVFVDYESEK
Download Length: 156 bp
>T116644 NZ_CP034797:c376628-376473 [Escherichia coli]
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
ATGAAGCAGCAAAAGGCGATGTTAATCGCCCTGATCGTCATCTGTTTAACCGTCATAGTGACGGCACTGGTAACGAGGAA
AGACCTCTGCGAGGTGCGAATCCGAACCGGTCAGACGGAGGTCGCTGTCTTCGTAGACTACGAATCTGAGAAGTAA
Antitoxin
Download Length: 59 bp
>AT116644 NZ_CP034797:376640-376698 [Escherichia coli]
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
CCTTGCCTTTCGGCACGTAAGAGGCTAACCTACATGTGTTCAGCATGGATTGAGCCTCA
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|