Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-rdlD/Ldr(toxin) |
| Location | 1930808..1931030 | Replicon | chromosome |
| Accession | NZ_CP032066 | ||
| Organism | Escherichia coli strain E166 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | S1NWX0 |
| Locus tag | D2J89_RS09230 | Protein ID | WP_001295224.1 |
| Coordinates | 1930923..1931030 (+) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | rdlD | ||
| Locus tag | - | ||
| Coordinates | 1930808..1930866 (-) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| D2J89_RS09210 | 1926679..1927662 | + | 984 | WP_001196486.1 | dipeptide ABC transporter ATP-binding protein | - |
| D2J89_RS09215 | 1927659..1928663 | + | 1005 | WP_000107036.1 | dipeptide ABC transporter ATP-binding subunit DppF | - |
| D2J89_RS09220 | 1928693..1929964 | - | 1272 | WP_001318103.1 | aromatic amino acid transport family protein | - |
| D2J89_RS09225 | 1930440..1930547 | + | 108 | WP_000170738.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 1930808..1930866 | - | 59 | - | - | Antitoxin |
| D2J89_RS09230 | 1930923..1931030 | + | 108 | WP_001295224.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| D2J89_RS09235 | 1931117..1932796 | - | 1680 | WP_001562264.1 | cellulose biosynthesis protein BcsG | - |
| D2J89_RS09240 | 1932793..1932984 | - | 192 | WP_000988308.1 | cellulose biosynthesis protein BcsF | - |
| D2J89_RS09245 | 1932981..1934552 | - | 1572 | WP_001204944.1 | cellulose biosynthesis c-di-GMP-binding protein BcsE | - |
| D2J89_RS09250 | 1934825..1935013 | + | 189 | WP_001063315.1 | cellulose biosynthesis protein BcsR | - |
| D2J89_RS09255 | 1935025..1935777 | + | 753 | Protein_1808 | cellulose biosynthesis protein BcsQ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3882.70 Da Isoelectric Point: 9.0157
>T110959 WP_001295224.1 NZ_CP032066:1930923-1931030 [Escherichia coli]
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
MTLAELGMAFWHDLAAPVIAGILASMIVNWLNKRK
Download Length: 108 bp
>T110959 NZ_CP032066:1930923-1931030 [Escherichia coli]
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
ATGACGCTCGCAGAGCTGGGCATGGCCTTCTGGCATGATTTAGCGGCTCCGGTCATTGCTGGCATTCTTGCCAGCATGAT
CGTGAACTGGCTGAACAAGCGGAAGTAA
Antitoxin
Download Length: 59 bp
>AT110959 NZ_CP032066:c1930866-1930808 [Escherichia coli]
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
TCAAGAATGGCCCCCGTGGTGTTGTCAGGTGCATACCTGCAACGTGCGGGGGTTTTCTC
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|