Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | ldrD-ohsC/Ldr(toxin) |
| Location | 2424280..2424501 | Replicon | chromosome |
| Accession | NZ_CP031916 | ||
| Organism | Escherichia coli O45:H2 strain FWSEC0003 | ||
Toxin (Protein)
| Gene name | ldrD | Uniprot ID | E0IV43 |
| Locus tag | CCU02_RS12375 | Protein ID | WP_000170926.1 |
| Coordinates | 2424280..2424387 (-) | Length | 36 a.a. |
Antitoxin (RNA)
| Gene name | ohsC | ||
| Locus tag | - | ||
| Coordinates | 2424440..2424501 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| CCU02_RS12340 | 2419589..2420671 | + | 1083 | WP_000804726.1 | peptide chain release factor 1 | - |
| CCU02_RS12345 | 2420671..2421504 | + | 834 | WP_000456459.1 | peptide chain release factor N(5)-glutamine methyltransferase | - |
| CCU02_RS12350 | 2421501..2421893 | + | 393 | WP_000200392.1 | invasion regulator SirB2 | - |
| CCU02_RS12355 | 2421897..2422706 | + | 810 | WP_001257044.1 | invasion regulator SirB1 | - |
| CCU02_RS12360 | 2422742..2423596 | + | 855 | WP_000811065.1 | 3-deoxy-8-phosphooctulonate synthase | - |
| CCU02_RS12365 | 2423745..2423852 | - | 108 | WP_000170954.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2423900..2423966 | + | 67 | NuclAT_41 | - | - |
| - | 2423900..2423966 | + | 67 | NuclAT_41 | - | - |
| - | 2423900..2423966 | + | 67 | NuclAT_41 | - | - |
| - | 2423900..2423966 | + | 67 | NuclAT_41 | - | - |
| - | 2423900..2423966 | + | 67 | NuclAT_44 | - | - |
| - | 2423900..2423966 | + | 67 | NuclAT_44 | - | - |
| - | 2423900..2423966 | + | 67 | NuclAT_44 | - | - |
| - | 2423900..2423966 | + | 67 | NuclAT_44 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_18 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_18 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_18 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_18 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_21 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_21 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_21 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_21 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_24 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_24 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_24 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_24 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_27 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_27 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_27 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_27 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_30 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_30 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_30 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_30 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_33 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_33 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_33 | - | - |
| - | 2423902..2423965 | + | 64 | NuclAT_33 | - | - |
| CCU02_RS12375 | 2424280..2424387 | - | 108 | WP_000170926.1 | type I toxin-antitoxin system toxin Ldr family protein | Toxin |
| - | 2424440..2424501 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_19 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_22 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_25 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_28 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_31 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_34 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_34 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_34 | - | Antitoxin |
| - | 2424440..2424501 | + | 62 | NuclAT_34 | - | Antitoxin |
| - | 2424440..2424502 | + | 63 | NuclAT_43 | - | - |
| - | 2424440..2424502 | + | 63 | NuclAT_43 | - | - |
| - | 2424440..2424502 | + | 63 | NuclAT_43 | - | - |
| - | 2424440..2424502 | + | 63 | NuclAT_43 | - | - |
| - | 2424440..2424502 | + | 63 | NuclAT_46 | - | - |
| - | 2424440..2424502 | + | 63 | NuclAT_46 | - | - |
| - | 2424440..2424502 | + | 63 | NuclAT_46 | - | - |
| - | 2424440..2424502 | + | 63 | NuclAT_46 | - | - |
| CCU02_RS12385 | 2424816..2424923 | - | 108 | WP_000170965.1 | type I toxin-antitoxin system toxin Ldr family protein | - |
| - | 2424971..2425036 | + | 66 | NuclAT_17 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_17 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_17 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_17 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_20 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_20 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_20 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_20 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_23 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_23 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_23 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_23 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_26 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_26 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_26 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_26 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_29 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_29 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_29 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_29 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_32 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_32 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_32 | - | - |
| - | 2424971..2425036 | + | 66 | NuclAT_32 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_35 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_35 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_35 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_35 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_36 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_36 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_36 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_36 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_37 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_37 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_37 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_37 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_38 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_38 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_38 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_38 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_39 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_39 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_39 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_39 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_40 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_40 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_40 | - | - |
| - | 2424971..2425038 | + | 68 | NuclAT_40 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_42 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_42 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_42 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_42 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_45 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_45 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_45 | - | - |
| - | 2424972..2425037 | + | 66 | NuclAT_45 | - | - |
| CCU02_RS12395 | 2425328..2426428 | - | 1101 | WP_001295620.1 | sodium-potassium/proton antiporter ChaA | - |
| CCU02_RS12400 | 2426698..2426928 | + | 231 | WP_001146442.1 | putative cation transport regulator ChaB | - |
| CCU02_RS12405 | 2427086..2427781 | + | 696 | WP_001297117.1 | glutathione-specific gamma-glutamylcyclotransferase | - |
| CCU02_RS12410 | 2427825..2428178 | - | 354 | WP_001169666.1 | DsrE/F sulfur relay family protein YchN | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 36 a.a. Molecular weight: 3983.84 Da Isoelectric Point: 11.6501
>T110731 WP_000170926.1 NZ_CP031916:c2424387-2424280 [Escherichia coli O45:H2]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK
Download Length: 108 bp
>T110731 NZ_CP031916:c2424387-2424280 [Escherichia coli O45:H2]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA
Antitoxin
Download Length: 62 bp
>AT110731 NZ_CP031916:2424440-2424501 [Escherichia coli O45:H2]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|