Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type I Classification (family/domain) ldrD-ohsC/Ldr(toxin)
Location 2424280..2424501 Replicon chromosome
Accession NZ_CP031916
Organism Escherichia coli O45:H2 strain FWSEC0003

Toxin (Protein)


Gene name ldrD Uniprot ID E0IV43
Locus tag CCU02_RS12375 Protein ID WP_000170926.1
Coordinates 2424280..2424387 (-) Length 36 a.a.

Antitoxin (RNA)


Gene name ohsC
Locus tag -
Coordinates 2424440..2424501 (+)

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
CCU02_RS12340 2419589..2420671 + 1083 WP_000804726.1 peptide chain release factor 1 -
CCU02_RS12345 2420671..2421504 + 834 WP_000456459.1 peptide chain release factor N(5)-glutamine methyltransferase -
CCU02_RS12350 2421501..2421893 + 393 WP_000200392.1 invasion regulator SirB2 -
CCU02_RS12355 2421897..2422706 + 810 WP_001257044.1 invasion regulator SirB1 -
CCU02_RS12360 2422742..2423596 + 855 WP_000811065.1 3-deoxy-8-phosphooctulonate synthase -
CCU02_RS12365 2423745..2423852 - 108 WP_000170954.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2423900..2423966 + 67 NuclAT_41 - -
- 2423900..2423966 + 67 NuclAT_41 - -
- 2423900..2423966 + 67 NuclAT_41 - -
- 2423900..2423966 + 67 NuclAT_41 - -
- 2423900..2423966 + 67 NuclAT_44 - -
- 2423900..2423966 + 67 NuclAT_44 - -
- 2423900..2423966 + 67 NuclAT_44 - -
- 2423900..2423966 + 67 NuclAT_44 - -
- 2423902..2423965 + 64 NuclAT_18 - -
- 2423902..2423965 + 64 NuclAT_18 - -
- 2423902..2423965 + 64 NuclAT_18 - -
- 2423902..2423965 + 64 NuclAT_18 - -
- 2423902..2423965 + 64 NuclAT_21 - -
- 2423902..2423965 + 64 NuclAT_21 - -
- 2423902..2423965 + 64 NuclAT_21 - -
- 2423902..2423965 + 64 NuclAT_21 - -
- 2423902..2423965 + 64 NuclAT_24 - -
- 2423902..2423965 + 64 NuclAT_24 - -
- 2423902..2423965 + 64 NuclAT_24 - -
- 2423902..2423965 + 64 NuclAT_24 - -
- 2423902..2423965 + 64 NuclAT_27 - -
- 2423902..2423965 + 64 NuclAT_27 - -
- 2423902..2423965 + 64 NuclAT_27 - -
- 2423902..2423965 + 64 NuclAT_27 - -
- 2423902..2423965 + 64 NuclAT_30 - -
- 2423902..2423965 + 64 NuclAT_30 - -
- 2423902..2423965 + 64 NuclAT_30 - -
- 2423902..2423965 + 64 NuclAT_30 - -
- 2423902..2423965 + 64 NuclAT_33 - -
- 2423902..2423965 + 64 NuclAT_33 - -
- 2423902..2423965 + 64 NuclAT_33 - -
- 2423902..2423965 + 64 NuclAT_33 - -
CCU02_RS12375 2424280..2424387 - 108 WP_000170926.1 type I toxin-antitoxin system toxin Ldr family protein Toxin
- 2424440..2424501 + 62 NuclAT_19 - Antitoxin
- 2424440..2424501 + 62 NuclAT_19 - Antitoxin
- 2424440..2424501 + 62 NuclAT_19 - Antitoxin
- 2424440..2424501 + 62 NuclAT_19 - Antitoxin
- 2424440..2424501 + 62 NuclAT_22 - Antitoxin
- 2424440..2424501 + 62 NuclAT_22 - Antitoxin
- 2424440..2424501 + 62 NuclAT_22 - Antitoxin
- 2424440..2424501 + 62 NuclAT_22 - Antitoxin
- 2424440..2424501 + 62 NuclAT_25 - Antitoxin
- 2424440..2424501 + 62 NuclAT_25 - Antitoxin
- 2424440..2424501 + 62 NuclAT_25 - Antitoxin
- 2424440..2424501 + 62 NuclAT_25 - Antitoxin
- 2424440..2424501 + 62 NuclAT_28 - Antitoxin
- 2424440..2424501 + 62 NuclAT_28 - Antitoxin
- 2424440..2424501 + 62 NuclAT_28 - Antitoxin
- 2424440..2424501 + 62 NuclAT_28 - Antitoxin
- 2424440..2424501 + 62 NuclAT_31 - Antitoxin
- 2424440..2424501 + 62 NuclAT_31 - Antitoxin
- 2424440..2424501 + 62 NuclAT_31 - Antitoxin
- 2424440..2424501 + 62 NuclAT_31 - Antitoxin
- 2424440..2424501 + 62 NuclAT_34 - Antitoxin
- 2424440..2424501 + 62 NuclAT_34 - Antitoxin
- 2424440..2424501 + 62 NuclAT_34 - Antitoxin
- 2424440..2424501 + 62 NuclAT_34 - Antitoxin
- 2424440..2424502 + 63 NuclAT_43 - -
- 2424440..2424502 + 63 NuclAT_43 - -
- 2424440..2424502 + 63 NuclAT_43 - -
- 2424440..2424502 + 63 NuclAT_43 - -
- 2424440..2424502 + 63 NuclAT_46 - -
- 2424440..2424502 + 63 NuclAT_46 - -
- 2424440..2424502 + 63 NuclAT_46 - -
- 2424440..2424502 + 63 NuclAT_46 - -
CCU02_RS12385 2424816..2424923 - 108 WP_000170965.1 type I toxin-antitoxin system toxin Ldr family protein -
- 2424971..2425036 + 66 NuclAT_17 - -
- 2424971..2425036 + 66 NuclAT_17 - -
- 2424971..2425036 + 66 NuclAT_17 - -
- 2424971..2425036 + 66 NuclAT_17 - -
- 2424971..2425036 + 66 NuclAT_20 - -
- 2424971..2425036 + 66 NuclAT_20 - -
- 2424971..2425036 + 66 NuclAT_20 - -
- 2424971..2425036 + 66 NuclAT_20 - -
- 2424971..2425036 + 66 NuclAT_23 - -
- 2424971..2425036 + 66 NuclAT_23 - -
- 2424971..2425036 + 66 NuclAT_23 - -
- 2424971..2425036 + 66 NuclAT_23 - -
- 2424971..2425036 + 66 NuclAT_26 - -
- 2424971..2425036 + 66 NuclAT_26 - -
- 2424971..2425036 + 66 NuclAT_26 - -
- 2424971..2425036 + 66 NuclAT_26 - -
- 2424971..2425036 + 66 NuclAT_29 - -
- 2424971..2425036 + 66 NuclAT_29 - -
- 2424971..2425036 + 66 NuclAT_29 - -
- 2424971..2425036 + 66 NuclAT_29 - -
- 2424971..2425036 + 66 NuclAT_32 - -
- 2424971..2425036 + 66 NuclAT_32 - -
- 2424971..2425036 + 66 NuclAT_32 - -
- 2424971..2425036 + 66 NuclAT_32 - -
- 2424971..2425038 + 68 NuclAT_35 - -
- 2424971..2425038 + 68 NuclAT_35 - -
- 2424971..2425038 + 68 NuclAT_35 - -
- 2424971..2425038 + 68 NuclAT_35 - -
- 2424971..2425038 + 68 NuclAT_36 - -
- 2424971..2425038 + 68 NuclAT_36 - -
- 2424971..2425038 + 68 NuclAT_36 - -
- 2424971..2425038 + 68 NuclAT_36 - -
- 2424971..2425038 + 68 NuclAT_37 - -
- 2424971..2425038 + 68 NuclAT_37 - -
- 2424971..2425038 + 68 NuclAT_37 - -
- 2424971..2425038 + 68 NuclAT_37 - -
- 2424971..2425038 + 68 NuclAT_38 - -
- 2424971..2425038 + 68 NuclAT_38 - -
- 2424971..2425038 + 68 NuclAT_38 - -
- 2424971..2425038 + 68 NuclAT_38 - -
- 2424971..2425038 + 68 NuclAT_39 - -
- 2424971..2425038 + 68 NuclAT_39 - -
- 2424971..2425038 + 68 NuclAT_39 - -
- 2424971..2425038 + 68 NuclAT_39 - -
- 2424971..2425038 + 68 NuclAT_40 - -
- 2424971..2425038 + 68 NuclAT_40 - -
- 2424971..2425038 + 68 NuclAT_40 - -
- 2424971..2425038 + 68 NuclAT_40 - -
- 2424972..2425037 + 66 NuclAT_42 - -
- 2424972..2425037 + 66 NuclAT_42 - -
- 2424972..2425037 + 66 NuclAT_42 - -
- 2424972..2425037 + 66 NuclAT_42 - -
- 2424972..2425037 + 66 NuclAT_45 - -
- 2424972..2425037 + 66 NuclAT_45 - -
- 2424972..2425037 + 66 NuclAT_45 - -
- 2424972..2425037 + 66 NuclAT_45 - -
CCU02_RS12395 2425328..2426428 - 1101 WP_001295620.1 sodium-potassium/proton antiporter ChaA -
CCU02_RS12400 2426698..2426928 + 231 WP_001146442.1 putative cation transport regulator ChaB -
CCU02_RS12405 2427086..2427781 + 696 WP_001297117.1 glutathione-specific gamma-glutamylcyclotransferase -
CCU02_RS12410 2427825..2428178 - 354 WP_001169666.1 DsrE/F sulfur relay family protein YchN -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Type I toxin-antitoxin system, toxin Ldr

(1-35)


Sequences

Toxin        


Download         Length: 36 a.a.        Molecular weight: 3983.84 Da        Isoelectric Point: 11.6501

>T110731 WP_000170926.1 NZ_CP031916:c2424387-2424280 [Escherichia coli O45:H2]
MTLAKFAMIFWHDLAAPILAGIITAAIVGWWRNRK

Download         Length: 108 bp

>T110731 NZ_CP031916:c2424387-2424280 [Escherichia coli O45:H2]
ATGACGCTCGCGAAGTTTGCCATGATTTTCTGGCACGACCTGGCAGCACCGATCCTGGCGGGGATTATTACCGCAGCGAT
TGTCGGCTGGTGGCGTAACCGGAAGTAA

Antitoxin


Download         Length: 62 bp

>AT110731 NZ_CP031916:2424440-2424501 [Escherichia coli O45:H2]
TGGTTCAAGATTAGCCCCCGTTCTGTTGTCAGGTTAAACCTCTCAACGTGCGGGGGTTTTCT

Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0E0Y1K9

Antitoxin

Download structure file

References