Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sok/- |
| Location | 54077..54341 | Replicon | plasmid pCARB35_03 |
| Accession | NZ_CP031656 | ||
| Organism | Escherichia coli strain UK_Dog_Liverpool | ||
Toxin (Protein)
| Gene name | pndA | Uniprot ID | U9Z417 |
| Locus tag | DL545_RS26720 | Protein ID | WP_001387489.1 |
| Coordinates | 54077..54229 (-) | Length | 51 a.a. |
Antitoxin (RNA)
| Gene name | pndB | ||
| Locus tag | - | ||
| Coordinates | 54281..54341 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DL545_RS27100 | 49642..49758 | + | 117 | Protein_58 | IncI1-type conjugal transfer lipoprotein TraH | - |
| DL545_RS26695 | 49757..51511 | + | 1755 | Protein_59 | DotA/TraY family protein | - |
| DL545_RS26700 | 51582..52244 | + | 663 | WP_000644796.1 | plasmid IncI1-type surface exclusion protein ExcA | - |
| DL545_RS26705 | 52316..52525 | - | 210 | WP_000062603.1 | HEAT repeat domain-containing protein | - |
| DL545_RS27105 | 52917..53093 | + | 177 | WP_001054897.1 | hypothetical protein | - |
| DL545_RS26710 | 53158..53454 | - | 297 | WP_011264046.1 | hypothetical protein | - |
| DL545_RS26715 | 53754..54005 | + | 252 | WP_001291964.1 | hypothetical protein | - |
| DL545_RS26720 | 54077..54229 | - | 153 | WP_001387489.1 | Hok/Gef family protein | Toxin |
| - | 54281..54341 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 54281..54341 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 54281..54341 | + | 61 | NuclAT_0 | - | Antitoxin |
| - | 54281..54341 | + | 61 | NuclAT_0 | - | Antitoxin |
| DL545_RS26725 | 54544..54891 | + | 348 | Protein_66 | protein finQ | - |
| DL545_RS26730 | 55077..56234 | + | 1158 | Protein_67 | IS1380-like element ISEc9 family transposase | - |
| DL545_RS26740 | 56290..56987 | + | 698 | Protein_68 | IS1 family transposase | - |
| DL545_RS26745 | 57001..57306 | - | 306 | Protein_69 | transcription termination factor NusG | - |
| DL545_RS26755 | 57748..58035 | - | 288 | WP_000074855.1 | conjugal transfer protein TraA | - |
| DL545_RS26760 | 57953..58216 | - | 264 | WP_032180564.1 | ash family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Conjugative plasmid | blaCMY-42 | - | 1..59142 | 59142 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 51 a.a. Molecular weight: 5761.10 Da Isoelectric Point: 8.7948
>T109645 WP_001387489.1 NZ_CP031656:c54229-54077 [Escherichia coli]
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
MPQRTFLMMLIVVCVTILCFVWMVRDSLCGLRLQQGNTVLVATLAYEVKR
Download Length: 153 bp
>T109645 NZ_CP031656:c54229-54077 [Escherichia coli]
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
ATGCCACAGCGAACGTTTTTAATGATGTTAATCGTCGTCTGTGTGACGATTCTGTGTTTTGTCTGGATGGTGAGGGATTC
GCTTTGCGGACTCCGGCTCCAGCAGGGAAACACAGTGCTTGTGGCAACGTTAGCCTACGAAGTTAAACGTTAA
Antitoxin
Download Length: 61 bp
>AT109645 NZ_CP031656:54281-54341 [Escherichia coli]
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
GAGGCATTACAGTAGAGCCCTTGGTTGATTGATAAAAAAATCTCCAGGGGCTTTCTGCTGT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|