Detailed information of TA system
Overview
TA module
| Type | I | Classification (family/domain) | hok-sib/- |
| Location | 164911..165144 | Replicon | chromosome |
| Accession | NZ_CP031653 | ||
| Organism | Escherichia coli strain UK_Dog_Liverpool | ||
Toxin (Protein)
| Gene name | hok | Uniprot ID | P11895 |
| Locus tag | DL545_RS00830 | Protein ID | WP_001312861.1 |
| Coordinates | 164986..165144 (+) | Length | 53 a.a. |
Antitoxin (RNA)
| Gene name | sib | ||
| Locus tag | - | ||
| Coordinates | 164911..164942 (+) |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| DL545_RS00815 | 160226..161137 | + | 912 | WP_001168544.1 | glycine--tRNA ligase subunit alpha | - |
| DL545_RS00820 | 161147..163216 | + | 2070 | WP_001291774.1 | glycine--tRNA ligase subunit beta | - |
| DL545_RS00825 | 163517..164886 | + | 1370 | WP_085947770.1 | IS3-like element IS150 family transposase | - |
| - | 164911..164942 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 164911..164942 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 164911..164942 | + | 32 | NuclAT_1 | - | Antitoxin |
| - | 164911..164942 | + | 32 | NuclAT_1 | - | Antitoxin |
| DL545_RS00830 | 164986..165144 | + | 159 | WP_001312861.1 | type I toxin-antitoxin system Hok family toxin | Toxin |
| DL545_RS00845 | 166065..166352 | + | 288 | WP_000107535.1 | hypothetical protein | - |
| DL545_RS00850 | 166470..167291 | + | 822 | WP_001234426.1 | DUF945 domain-containing protein | - |
| DL545_RS00855 | 167588..168190 | - | 603 | WP_013362798.1 | transglycosylase SLT domain-containing protein | - |
| DL545_RS00860 | 168511..168894 | + | 384 | WP_001151524.1 | relaxosome protein TraM | - |
| DL545_RS00865 | 169081..169770 | + | 690 | WP_000283385.1 | conjugal transfer transcriptional regulator TraJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 53 a.a. Molecular weight: 6082.32 Da Isoelectric Point: 9.2584
>T109616 WP_001312861.1 NZ_CP031653:164986-165144 [Escherichia coli]
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
MKLPRSSLVWCVLIVCLTLLIFTYLTRKSLCEIRYRDGHREVAAFMAYESGK
Download Length: 159 bp
>T109616 NZ_CP031653:164986-165144 [Escherichia coli]
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
ATGAAACTACCACGAAGTTCCCTTGTCTGGTGTGTGTTGATCGTGTGTCTCACACTGTTGATATTCACTTATCTGACACG
AAAATCGCTGTGCGAGATTCGTTACAGAGACGGACACAGGGAGGTGGCGGCTTTCATGGCTTACGAATCCGGTAAGTAG
Antitoxin
Download Length: 32 bp
>AT109616 NZ_CP031653:164911-164942 [Escherichia coli]
CACCACGAGGCATCCCTATGTCTAGTCCACAT
CACCACGAGGCATCCCTATGTCTAGTCCACAT
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|